Sequence 1: | NP_056428.1 | Gene: | LRIT1 / 26103 | HGNCID: | 23404 | Length: | 623 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
Alignment Length: | 296 | Identity: | 57/296 - (19%) |
---|---|---|---|
Similarity: | 88/296 - (29%) | Gaps: | 110/296 - (37%) |
- Green bases have known domain annotations that are detailed below.
Human 268 GGTALLRCGATGVPGPEMSWRRANGRP--LNGT--VHQEVSSDGTSWTLLGLPAVSHLDSGDYIC 328
Human 329 QAKNFLGAS----------------------------ETVISLIVTEPPTSTEHSGSPGALWART 365
Human 366 GGG--GEAAAYNNKLVARHVPQIPKPAVLATGPSVPSTKEELTLEHFQMDALGELSDGRAGPSEA 428
Human 429 RMVRSVKVVGDTYHSVSLVWKAP------------QAKNTTAFSVL-------------YAVFGQ 468
Human 469 HSMRRVIV-------------QPGKTRVTITGLLPK 491 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
LRIT1 | NP_056428.1 | LRR 1 | 60..81 | ||
leucine-rich repeat | 61..84 | CDD:275378 | |||
LRR_8 | 63..143 | CDD:290566 | |||
LRR 2 | 84..105 | ||||
leucine-rich repeat | 85..132 | CDD:275378 | |||
LRR 3 | 108..129 | ||||
LRR_8 | 131..202 | CDD:290566 | |||
LRR_4 | 131..171 | CDD:289563 | |||
LRR 4 | 132..153 | ||||
leucine-rich repeat | 133..156 | CDD:275378 | |||
LRR 5 | 156..177 | ||||
leucine-rich repeat | 157..180 | CDD:275378 | |||
leucine-rich repeat | 181..205 | CDD:275378 | |||
TPKR_C2 | 201..>240 | CDD:301599 | |||
Ig | 267..345 | CDD:299845 | 26/108 (24%) | ||
IG_like | 267..345 | CDD:214653 | 26/108 (24%) | ||
FN3 | 431..498 | CDD:214495 | 15/99 (15%) | ||
LRR 6. /evidence=ECO:0000305 | 571..594 | ||||
DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | |
Ig | 69..139 | CDD:143165 | |||
IG_like | 165..249 | CDD:214653 | 26/81 (32%) | ||
IGc2 | 172..237 | CDD:197706 | 25/69 (36%) | ||
IG_like | 267..348 | CDD:214653 | 18/112 (16%) | ||
Ig | 270..339 | CDD:299845 | 16/100 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |