DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LRIT1 and tutl

DIOPT Version :9

Sequence 1:NP_056428.1 Gene:LRIT1 / 26103 HGNCID:23404 Length:623 Species:Homo sapiens
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:488 Identity:100/488 - (20%)
Similarity:163/488 - (33%) Gaps:189/488 - (38%)


- Green bases have known domain annotations that are detailed below.


Human   267 LGGTALLRCGATGVPGPEMSWRRANGRPLNGTVHQEVSSDGTSWTLLGLPAVSHLDSGDYICQAK 331
            ||.:.:|.|.|.|.|.||:.|.: :..|::.:....:.:|||.   |.:..:.|.|.|:|.|.|:
  Fly   267 LGDSIILNCQADGTPTPEILWYK-DANPVDPSPTVGIFNDGTE---LRISTIRHEDIGEYTCIAR 327

Human   332 NFLG----ASETVIS--LIVTEPPT------------STEHSGSPGAL---WARTGGG-GEAAAY 374
            |..|    .:..:|:  .::..|||            |.|....||.:   |.|.|.. .|.||.
  Fly   328 NGEGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAAL 392

Human   375 NNKLVARH--------------------------VPQ-------IPKPAVLATGPSV-------- 398
            ..::..|.                          .||       :..||.:...|:|        
  Fly   393 ETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQYLPFRLA 457

Human   399 ----------PS------TKEELTLEHFQMD-----ALGEL-------------------SDGRA 423
                      |.      ||::..||.:||.     |.|.|                   :.|.|
  Fly   458 GVVQCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYACTPYNAQGTA 522

Human   424 GPSEAR--MVRS------------VKVVGDTYHSVSLVWKAPQAKNTTAFSVLYAVFGQHSMRRV 474
            |.|...  :||.            .:.|||   ||.:...|.:|:.|...::.:    |......
  Fly   523 GASGVMDVLVRKPPAFTVEPETLYQRKVGD---SVEMHCDALEAEGTERPTIKW----QRQEGEQ 580

Human   475 IVQPGKTRVTITGLLPKTKYVACVCVQGLVPRKE-----QCVIFSTNEVVDAENTQQLINVVVIS 534
            :.:..:.|:.|:|        ..:.::.|  |:|     |||:  :|||.......||:      
  Fly   581 LTESQRNRIKISG--------GNITIENL--RREDFGYYQCVV--SNEVATLMAVTQLV------ 627

Human   535 VAIVIALPLTLLVCCSALQKRCRKCFNKDSTEATVTYVNLERL-GYS--------------EDGL 584
                          ....|..........:||:::|   |:.| |||              |.|:
  Fly   628 --------------IEGTQPHAPYNITGKATESSIT---LQWLPGYSGGSEYKQDYTIWFREAGV 675

Human   585 EELSRHSVSEADRL------LSARSSVDFQAFG 611
            .:....||:.:...      |::.::.:||..|
  Fly   676 NDWQTISVTPSGSTQVTINGLASGTTYEFQVVG 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LRIT1NP_056428.1 LRR 1 60..81
leucine-rich repeat 61..84 CDD:275378
LRR_8 63..143 CDD:290566
LRR 2 84..105
leucine-rich repeat 85..132 CDD:275378
LRR 3 108..129
LRR_8 131..202 CDD:290566
LRR_4 131..171 CDD:289563
LRR 4 132..153
leucine-rich repeat 133..156 CDD:275378
LRR 5 156..177
leucine-rich repeat 157..180 CDD:275378
leucine-rich repeat 181..205 CDD:275378
TPKR_C2 201..>240 CDD:301599
Ig 267..345 CDD:299845 24/83 (29%)
IG_like 267..345 CDD:214653 24/83 (29%)
FN3 431..498 CDD:214495 14/78 (18%)
LRR 6. /evidence=ECO:0000305 571..594 9/37 (24%)
tutlNP_001303307.1 V-set 137..250 CDD:284989
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352 23/77 (30%)
IGc2 268..331 CDD:197706 21/66 (32%)
I-set 346..437 CDD:254352 16/90 (18%)
Ig 349..437 CDD:299845 16/87 (18%)
Ig 459..530 CDD:299845 14/70 (20%)
IG_like 549..628 CDD:214653 23/117 (20%)
IGc2 551..617 CDD:197706 18/84 (21%)
FN3 633..725 CDD:238020 16/79 (20%)
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.