| Sequence 1: | NP_056428.1 | Gene: | LRIT1 / 26103 | HGNCID: | 23404 | Length: | 623 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_723103.1 | Gene: | DIP-theta / 33795 | FlyBaseID: | FBgn0051646 | Length: | 606 | Species: | Drosophila melanogaster |
| Alignment Length: | 233 | Identity: | 62/233 - (26%) |
|---|---|---|---|
| Similarity: | 96/233 - (41%) | Gaps: | 51/233 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Human 268 GGTALLRCGATGVPGPEMSWRRANGR--PL-NGTVHQEVSSDGTSWTLLGLPAVSHLDSGDYICQ 329
Human 330 AKNFLGASETV---ISLIVTEPPTSTEHSGSPGALWARTGGGGEAAAYNNKLVARHVPQIPK--- 388
Human 389 -----PAVLATGPS-VPSTKEE-----LTLEHFQMDALGELSDGRAGPSEARMVRSVKVVGDTYH 442
Human 443 SVSLVWKAPQAKNTTAFSVLYAVFGQHSMRRVIVQPGK 480 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| LRIT1 | NP_056428.1 | LRR 1 | 60..81 | ||
| leucine-rich repeat | 61..84 | CDD:275378 | |||
| LRR_8 | 63..143 | CDD:290566 | |||
| LRR 2 | 84..105 | ||||
| leucine-rich repeat | 85..132 | CDD:275378 | |||
| LRR 3 | 108..129 | ||||
| LRR_8 | 131..202 | CDD:290566 | |||
| LRR_4 | 131..171 | CDD:289563 | |||
| LRR 4 | 132..153 | ||||
| leucine-rich repeat | 133..156 | CDD:275378 | |||
| LRR 5 | 156..177 | ||||
| leucine-rich repeat | 157..180 | CDD:275378 | |||
| leucine-rich repeat | 181..205 | CDD:275378 | |||
| TPKR_C2 | 201..>240 | CDD:301599 | |||
| Ig | 267..345 | CDD:299845 | 30/82 (37%) | ||
| IG_like | 267..345 | CDD:214653 | 30/82 (37%) | ||
| FN3 | 431..498 | CDD:214495 | 11/50 (22%) | ||
| LRR 6. /evidence=ECO:0000305 | 571..594 | ||||
| DIP-theta | NP_723103.1 | Ig | 137..230 | CDD:299845 | |
| IG_like | 137..230 | CDD:214653 | |||
| IG_like | 240..324 | CDD:214653 | 30/82 (37%) | ||
| IGc2 | 247..310 | CDD:197706 | 25/66 (38%) | ||
| Ig | 327..419 | CDD:299845 | 22/111 (20%) | ||
| IG_like | 343..420 | CDD:214653 | 18/87 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||