DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPN20 and PTP-ER

DIOPT Version :9

Sequence 1:NP_001035816.1 Gene:PTPN20 / 26095 HGNCID:23423 Length:420 Species:Homo sapiens
Sequence 2:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster


Alignment Length:672 Identity:136/672 - (20%)
Similarity:212/672 - (31%) Gaps:302/672 - (44%)


- Green bases have known domain annotations that are detailed below.


Human     3 SPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRNF------ 61
            |..|.:..|     ..||..||.....|...:.......::....:..||:.|:.|.:.      
  Fly   750 SASDLQPNP-----QQDSVREDQAIGATCTCAGTVRNIMTRPLSPQTTSEEFKIYLASIQMLQSA 809

Human    62 --PHNDYE----------------DVFEEPSESGSDPSMWTARGPFRRDRWSSEDEEAAGPSQAL 108
              |.|.::                ::.|:|...||:          .||..:..|  ...||...
  Fly   810 SNPLNQFDLIRLNYVFDHSYQTNRNIIEQPPVLGSN----------ARDVETPTD--MVPPSSED 862

Human   109 SPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPG 173
            |.||:..:.:||     ::||..|.             ||..|:|....|:.:||..|.|.:...
  Fly   863 SELLASYQTVVS-----RMAQPIPE-------------LKENEQKRIFRDLHKEFWDLPLNHQEK 909

Human   174 EFNSGNQPSNREKNRYRDILPYDSTRV-----------PLGKSK-----------DYINASYIRI 216
            ....|:|    .||||:.|||.:::||           .||:.|           .||||:||: 
  Fly   910 PMVFGSQ----TKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIK- 969

Human   217 VNCGEEYF---YIATQGPLLSTIDDFWQMVLENNSNV---------------------------I 251
               |.:|.   |:||||||.:||.:||.|:.:|....                           |
  Fly   970 ---GPDYVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKI 1031

Human   252 AMITREIEGGIIKCYHYWPISLK------------------------------------------ 274
            .|:|...|....||..|:||.|.                                          
  Fly  1032 VMLTNFTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAI 1096

Human   275 ------KPLELKHFRVFLENYQILQ-------YFIIRMFQVVEKSTGTSHSVKQL---------- 316
                  :.:.::..:|.||. .:|:       :|:|:...:|.::   .:||::|          
  Fly  1097 DYEISGRHIGVESVKVTLEG-DLLEALPAQGSFFLIKNVGIVRRN---GYSVRKLVLLYCIRVPQ 1157

Human   317 --------------QFTKWPDHGTPASADSFIKY-------------------IRYARKSHLTG- 347
                          .:..||||.:|...::.:..                   .|..|.:||.. 
  Fly  1158 SASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQ 1222

Human   348 --------------PM-VVHCSAGIGRTGVFLCV------------------------------- 366
                          |: |:||||||||||.|..:                               
  Fly  1223 RLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEY 1287

Human   367 ------DVVF-CAIVKNCS---------------------------FNIMDIVAQMREQRSGMVQ 397
                  |..| |..:::.|                           .:::.||..:|.||.||||
  Fly  1288 HNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQ 1352

Human   398 TKEQYHFCYDIVLEVLRKLLTL 419
            ..|||...:..:...|::.|.|
  Fly  1353 NSEQYELIHRAICLYLKRTLAL 1374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPN20NP_001035816.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 8/43 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..108 9/39 (23%)
PTPc 159..411 CDD:214550 97/482 (20%)
PTPc 185..411 CDD:238006 91/456 (20%)
Substrate binding. /evidence=ECO:0000250 353..359 5/5 (100%)
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 92/459 (20%)
PTPc 917..1364 CDD:238006 91/454 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.