DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or94b

DIOPT Version :9

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:361 Identity:75/361 - (20%)
Similarity:139/361 - (38%) Gaps:42/361 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YTAYSMVWNVTFHICIWVSFSVNLLQSNSLETFCESLCVTMPHTLYMLKLINVRRMRGEMISSHW 101
            :|..:::|             ...:.|:..|...:.|.:::.....:.||:|:...|.|..|   
  Fly    51 FTYIALMW-------------YEAITSSDFEEAGQVLYMSITELALVTKLLNIWYRRHEAAS--- 99

  Fly   102 LLRLL--DKRLGCADERQIIMAGIERAEF--IFRTIFRGLACTVVLGIIYISASSEPTLMYPTWI 162
            |:..|  |......:..:|......:..|  ||.....|.....|:|.|.:....:..|.:..::
  Fly   100 LIHELQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWYIWGSLFVAVMGYISVFFQEDYELPFGYYV 164

  Fly   163 PWNWKDSTSAYLA---TAMLHTTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGA- 223
            |:.|:.....:.|   ..:..|...::| .|:..|..|   ::..::...:.|.:|:..|...| 
  Fly   165 PFEWRTRERYFYAWGYNVVAMTLCCLSN-ILLDTLGCY---FMFHIASLFRLLGMRLEALKNAAE 225

  Fly   224 --PLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMR 286
              ..|.:|....|      |..:.||.:..|..:|.....|...:|...|...|.|:  ::|..:
  Fly   226 EKARPELRRIFQL------HTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLV--HMGFKQ 282

  Fly   287 ----FMNMLFLLVILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQI 347
                |:..:..:.::..:..|.||..........:|..:|:..|||..||..|:||...:...:.
  Fly   283 RPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKR 347

  Fly   348 PMILVSGVIVPISMKTFTVMIKGAYTMLTLLNEIRK 383
            |:.:.:||...|.:..|...|..||:...||.:|.|
  Fly   348 PVKVRAGVFFEIGLPIFVKTINNAYSFFALLLKISK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 66/320 (21%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 66/320 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466060
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.