DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or94a

DIOPT Version :9

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:422 Identity:90/422 - (21%)
Similarity:166/422 - (39%) Gaps:94/422 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KVDSTRALVNHWRIFRIMGIHPPGKR-----TFWGRHYTAYSMVWNV----TFHICIWVSFSVNL 60
            :::|.|.::   ::.::.|:.|...:     ||.|.....|..:.::    ||...:|:...:  
  Fly     7 RIESMRLIL---QVMQLFGLWPWSLKSEEEWTFTGFVKRNYRFLLHLPITFTFIGLMWLEAFI-- 66

  Fly    61 LQSNSLETFCESLCVTMPHTLYMLKLINVRRMRGEMISSHWLLRLL-------DKRLGCADERQI 118
              |::||...:.|.:::.....::|::::...|.|.    |  ||:       |.:|...:|   
  Fly    67 --SSNLEQAGQVLYMSITEMALVVKILSIWHYRTEA----W--RLMYELQHAPDYQLHNQEE--- 120

  Fly   119 IMAGIERAE--------FIFRTIFRGLACTVVLGIIYISASSEPTLMYPTWIPWNWKDSTSAYLA 175
              ....|.|        :|:..|..|:..:...|::::.....|...|   :|:.|::....:.|
  Fly   121 --VDFWRREQRFFKWFFYIYILISLGVVYSGCTGVLFLEGYELPFAYY---VPFEWQNERRYWFA 180

  Fly   176 -----TAMLHTTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLG-------YGAPLPAV 228
                 ..|  |...::|.||. .|..|   :|..:|:..:.|.||:.:..       :|..|.|:
  Fly   181 YGYDMAGM--TLTCISNITLD-TLGCY---FLFHISLLYRLLGLRLRETKNMKNDTIFGQQLRAI 239

  Fly   229 RMQAILVGYIHDHQIILRLFKSLERSLSMTC--------FLQFFSTACAQCTICYFLLFGNVGIM 285
            .:.         ||.|        |||::||        ..|...:|...|...|.|  .:|||.
  Fly   240 FIM---------HQRI--------RSLTLTCQRIVSPYILSQIILSALIICFSGYRL--QHVGIR 285

  Fly   286 ----RFMNMLFLLVILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQ 346
                :|::||..:.::..:..|.||...........|...||..|||......|:||...:...:
  Fly   286 DNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLK 350

  Fly   347 IPMILVSGVIVPISMKTFTVMIKGAYTMLTLL 378
            .|:.:.:|....:.:..|...|..||:.|.||
  Fly   351 KPVTIRAGNFFAVGLPIFVKTINNAYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 73/345 (21%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 73/345 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.