DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or83a

DIOPT Version :9

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:443 Identity:79/443 - (17%)
Similarity:158/443 - (35%) Gaps:114/443 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DSTRALVNHWRIFRIMGIHPPGKRTFWGRHYTAYSMVWNVTFHIC-IWVSFSVNLLQSNSLETFC 70
            |.|..|.|::....|.|:                        :|| |::::.     ...|:.|.
  Fly    53 DLTYELFNYFVSVHIAGL------------------------YICTIYINYG-----QGDLDFFV 88

  Fly    71 ESLCVTMPHTLYMLKLINVRRMRGEMISSHWLLRLLDKRLGCADERQ---------IIMAGIERA 126
            ..|..|:.:...:...:..||.|..::::  :|..::      ||.:         :.|||..|.
  Fly    89 NCLIQTIIYLWTIAMKLYFRRFRPGLLNT--ILSNIN------DEYETRSAVGFSFVTMAGSYRM 145

  Fly   127 EFIFRTIFRGLACTVVLGIIYIS---ASSEPTLMYPTWIPWNWKDS-----------------TS 171
            ..::...:  :.|..:..|.:::   |..:.:|....|.|:::...                 .:
  Fly   146 SKLWIKTY--VYCCYIGTIFWLALPIAYRDRSLPLACWYPFDYTQPGVYEVVFLLQAMGQIQVAA 208

  Fly   172 AYLATAMLH------------------------TTALM-ANATLVLNLSS-------YPGTYLIL 204
            ::.:::.||                        :..|| ||.|.:..|.:       .||.|...
  Fly   209 SFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAYS 273

  Fly   205 VSVHTKALALRVSKLGYGAPL---PAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFST 266
            |...|....|    |..|:.:   .|.|:.  .|..|..|:.|:...|.:|...|...|::....
  Fly   274 VEEETPLQEL----LKVGSSMDFSSAFRLS--FVRCIQHHRYIVAALKKIESFYSPIWFVKIGEV 332

  Fly   267 ACAQCTICYFLLFGNVGIMRFMNMLFL---LVILTTETLLLCYTAELPCKEGESLLTAVYSCNWL 328
            ....|.:. |:...:.....||.|:.|   |:::..|..::||.|::..:..:....|::...|.
  Fly   333 TFLMCLVA-FVSTKSTAANSFMRMVSLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQ 396

  Fly   329 SQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLLNEI 381
            ....:.|...:..:...:....|.:|.|..:::..|...|..|::.||||.::
  Fly   397 RHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRFRGTITTAFSFLTLLQKM 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 65/373 (17%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 51/291 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.