DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or67b

DIOPT Version :9

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:417 Identity:80/417 - (19%)
Similarity:155/417 - (37%) Gaps:121/417 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YTAYSMVWNV------------TFHICIWVSFS-----VNLLQSN---SLETFCESLCVTMPHTL 81
            |:||::..|:            |..:.:.|:.|     |..:..|   |.||:.|::.:|...::
  Fly    25 YSAYALGVNIAPRKRSSKYCRLTRILVLIVNLSIIYSLVAFIMENYMISFETYVEAVLLTFQLSV 89

  Fly    82 YMLKLINVRRM------------RGEMISSHWLLRL-LDKRLGCADERQIIMAG----IERAEFI 129
            .::|:.:.:..            .||::.|..|.:| |.::........:|:..    |:|....
  Fly    90 GVVKMFHFQNKVESCSQLVFSTETGEVLKSLGLFQLDLPRKKELLSSVSLILLNNWMIIDRQVMF 154

  Fly   130 FRTIFRGLACTVVLGIIYISA----------------SSEPTLMYPTWIPW----NWKDSTSAYL 174
            |..|       |.:.::|...                :.|.||.||..:|:    |::  ..:|:
  Fly   155 FFKI-------VCMPVLYYCVRPYFQYIFDCYIKDKDTCEMTLTYPAIVPYLQLGNYE--FPSYV 210

  Fly   175 ATAMLHTT-------ALMANATLVLNLSSYPGTYL----ILVSVHTKALAL----RVSKLGYGAP 224
            ....|..:       |:....:|.:.|:.|....:    .||...|..:.:    ||..|..   
  Fly   211 IRFFLLQSGPLWCFFAVFGFNSLFVVLTRYESGLIKVLRFLVQNSTSDILVPKDQRVKYLQC--- 272

  Fly   225 LPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMR--- 286
              .||:.|.:..:   |..|..|||          ::.....:.:...|| .||:....::.   
  Fly   273 --CVRLFARISSH---HNQIENLFK----------YIILVQCSVSSILIC-MLLYKISTVLEVGW 321

  Fly   287 -FMNMLFL-LVILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPM 349
             :|.|:.: .|.:..|..|...:|:....:.|.|....|:|:|.::|..|:.::.:||.      
  Fly   322 VWMGMIMVYFVTIALEITLYNVSAQKVESQSELLFHDWYNCSWYNESREFKFMIKMMLL------ 380

  Fly   350 ILVSGVIVPISMKTFTVMIKGAYTMLT 376
                     .|.:||.:.: |.:|.|:
  Fly   381 ---------FSRRTFVLSV-GGFTSLS 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 69/363 (19%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 47/238 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465190
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.