DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or49a

DIOPT Version :9

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:430 Identity:84/430 - (19%)
Similarity:160/430 - (37%) Gaps:121/430 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IFRIMG---IHPPGKRTFWG----RHYTAYSMVWN------VTFHICIWVSFSVNLLQSNSLETF 69
            :|:.:|   .|.|  :.:|.    |.|.....:.|      ||..|..|.|     |..:..:..
  Fly    17 MFKTLGYDLFHTP--KPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWES-----LAGSPSKIM 74

  Fly    70 CESLCVTMPHTLYMLK--------LINVRRMRGEMISSHWLLRLLDKR-------------LGCA 113
            .:.|     |..|||.        :||.:|:   :..||.|..|...:             |.|:
  Fly    75 RQGL-----HFFYMLSSQLKFITFMINRKRL---LQLSHRLKELYPHKEQNQRKYEVNKYYLSCS 131

  Fly   114 DER--------QIIMA-------------GIERAEFIFRTIFRGLACTVVLGIIYISASSEPTLM 157
            ...        .::||             |..:|:|.::.||                       
  Fly   132 TRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIF----------------------- 173

  Fly   158 YPTWIPWNWKDSTSAYLATAMLHTTALMANATLVLNLSSYPGTYLIL------VSVHTKALALRV 216
             ||.:.:: .:....|:...::..|    .:..::|:|.  ||.|.:      :|:|...||..:
  Fly   174 -PTRLTFD-SEKPLGYVLAYVIDFT----YSQFIVNVSL--GTDLWMMCVSSQISMHLGYLANML 230

  Fly   217 SKLGYGAPLPAVRMQ--AILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLL- 278
            :.:   .|.|....|  ..|...|..||:::||.|.:.....:......|:|:|..|.:.|:.: 
  Fly   231 ASI---RPSPETEQQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVV 292

  Fly   279 --FGNVGIMRFMNMLFLLVILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLM 341
              |...||    :.:.|...:..:..::....::......:|..|.:...|...|:.:::.:|::
  Fly   293 EGFNWEGI----SYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILIL 353

  Fly   342 LARCQIPM-ILVSGVIVPISMKTFTVMIKGAYTMLTLLNE 380
            :|:.|.|: |...|||: ||:.||.:::...|....::.:
  Fly   354 MAQAQRPLEISARGVII-ISLDTFKILMTITYRFFAVIRQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 69/360 (19%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 64/337 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465878
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.