DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or10a

DIOPT Version :9

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:419 Identity:82/419 - (19%)
Similarity:149/419 - (35%) Gaps:97/419 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IMGIHPPGKRTFWGRHYTAYSMVWNVTFH---ICIWVSFSVN----LLQSNSLETFCESLCVTMP 78
            ||| :.|||        |..:..|....|   :.|.|:..::    .|....:....|:||....
  Fly    28 IMG-YWPGK--------TGDTWPWRSLIHFAILAIGVATELHAGMCFLDRQQITLALETLCPAGT 83

  Fly    79 HTLYMLKLINVRRMRGEMISSHW-LLR--LLDKRLGCADERQI-IMAGIERAEFIFRTIFRG-LA 138
            ..:.:||:..:.|.|.: :|..| .||  |.|......::|.| :......|...|..:..| ..
  Fly    84 SAVTLLKMFLMLRFRQD-LSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFWPLSAGFFT 147

  Fly   139 CT-------VVLGIIYISASSEPTLMYPTWIPWNWKDSTSAYLATAMLHTTALMANATLVLNLSS 196
            ||       ::..|:|:....|..:.:   .|:|                   |....::||...
  Fly   148 CTTYNLKPILIAMILYLQNRYEDFVWF---TPFN-------------------MTMPKVLLNYPF 190

  Fly   197 YPGTYLILV--------------------SVHTKAL-----------------ALRVSKLGYGAP 224
            :|.||:.:.                    ..|..||                 .|.:|      |
  Fly   191 FPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELS------P 249

  Fly   225 LPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACA-QCTICYFLLFGNVGIMRFM 288
            :....::..:...|..|..|:.|.:......::.....|.|.|.. ..::...|..||.|:...:
  Fly   250 VQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAML 314

  Fly   289 NMLFLLVILTTETLLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVS 353
            .:.:.:..| ::.|:.||...|..:....|..|::||.|.......|||:.|::.|.|.|:.:..
  Fly   315 YVAYTVAAL-SQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAV 378

  Fly   354 GVIVPISMKTFTVMIKGAYTMLTLLNEIR 382
            ....| |:.||..:::.:.:::.|:...:
  Fly   379 PFFSP-SLATFAAILQTSGSIIALVKSFQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 69/356 (19%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 69/356 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.