DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19b and Or9a

DIOPT Version :9

Sequence 1:NP_728315.1 Gene:Or19b / 260693 FlyBaseID:FBgn0062565 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:423 Identity:93/423 - (21%)
Similarity:152/423 - (35%) Gaps:120/423 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IFRIMGIHPPGKRTFWGRHYTAYSMVWNVTF-HICIWVSF----------------------SVN 59
            ::|.|||.                 :|:.|. :...|::|                      .|:
  Fly    23 VYRCMGID-----------------LWSPTMANDRPWLTFVTMGPLFLFMVPMFLAAHEYITQVS 70

  Fly    60 LLQSNSLETFCESLCVTMPHTLYMLKLINVRRMRGEMISSHWLLR-LLDKRLGC-ADERQIIMAG 122
            ||......||...|.        ::|.:.....|.|.:...:.:| :|.|.:.. .|.|:||...
  Fly    71 LLSDTLGSTFASMLT--------LVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIEVE 127

  Fly   123 IERAEFIFRTIFR--GL-----ACTVVLGIIYISASSEP-----------------TLMY-PTWI 162
            .:..:.:..|..|  ||     |....:|||..|...:.                 .:.| ||::
  Fly   128 NQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMFYVPTYL 192

  Fly   163 PWNWKDSTSAYLATAMLHTTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLPA 227
             ||...|.||.       |.||..::  :|...:|....:..::.|..            ..|||
  Fly   193 -WNVMASYSAV-------TMALCVDS--LLFFFTYNVCAIFKIAKHRM------------IHLPA 235

  Fly   228 VRMQAILVGYIHD---HQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFL--LFGNVGIMRF 287
            |..:..|.|.:..   ||..|::...:........|||||.:|...|.|.:.:  ||.|...:.|
  Fly   236 VGGKEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYF 300

  Fly   288 MNMLFLLVILTTETLLLCYTAELPCKEGESLLTA-------VYSCNWLSQSVNFRRLLLLMLARC 345
            :..:..|:|     .|..|:     |.||::.:|       :|..||...|...:|.||:...|.
  Fly   301 IAFVGSLLI-----ALFIYS-----KCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRA 355

  Fly   346 QIPMILVSGVIVPISMKTFTVMIKGAYTMLTLL 378
            |.| ..:.|.....||.||:.:::.|.:.:.:|
  Fly   356 QRP-CQMKGYFFEASMATFSTIVRSAVSYIMML 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19bNP_728315.1 7tm_6 65..372 CDD:251636 80/345 (23%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 83/353 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.