DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vas and RH36

DIOPT Version :9

Sequence 1:NP_001260458.1 Gene:vas / 26067080 FlyBaseID:FBgn0283442 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_173078.1 Gene:RH36 / 838197 AraportID:AT1G16280 Length:491 Species:Arabidopsis thaliana


Alignment Length:382 Identity:145/382 - (37%)
Similarity:200/382 - (52%) Gaps:34/382 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 FSKYNNIPVKVTGSDVPQPIQHFTSA------DLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGR 283
            |.|:.|          |.|....|||      .|.:..::...:.|.:.|||:|...:|.|.:||
plant    42 FEKFTN----------PNPSSDTTSATNFEGLGLAEWAVETCKELGMRKPTPVQTHCVPKILAGR 96

  Fly   284 DLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLK 348
            |::..|||||||||||.||||.:|.|||:.:     ..::|:||||||.|:..:.:.......|:
plant    97 DVLGLAQTGSGKTAAFALPILHRLAEDPYGV-----FALVVTPTRELAFQLAEQFKALGSCLNLR 156

  Fly   349 IGIVYGGTSFRHQNECITRGCHVVIATPGR---LLDFVDRTFITFEDTRFVVLDEADRMLDMGFS 410
            ..::.||.....|...:....|:||.||||   ||:........|..|:|:|||||||:||:||.
plant   157 CSVIVGGMDMLTQTMSLVSRPHIVITTPGRIKVLLENNPDVPPVFSRTKFLVLDEADRVLDVGFQ 221

  Fly   411 EDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSD--VKQTIYEVN 473
            :::|.|..  .:....|||:||||....:|.:. |...|..:......|....|  .:|.|:| :
plant   222 DELRTIFQ--CLPKSRQTLLFSATMTSNLQALL-EHSSNKAYFYEAYEGLKTVDTLTQQFIFE-D 282

  Fly   474 KYAKRSKLIEILSEQAD----GTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRD 534
            |.||...|:.|||:..|    ..::||.|.|....|:..|.|.|....::|....||.|..||..
plant   283 KDAKELYLVHILSQMEDKGIRSAMIFVSTCRTCQRLSLMLDELEVENIAMHSLNSQSMRLSALSK 347

  Fly   535 FKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATS 591
            ||:|.:.:|:||.||||||||..:..|||||:|....|||||:|||.|.|..|.|.|
plant   348 FKSGKVPILLATDVASRGLDIPTVDLVINYDIPRDPRDYVHRVGRTARAGRGGLAVS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vasNP_001260458.1 DEADc 247..454 CDD:238167 80/215 (37%)
DEXDc 260..467 CDD:214692 78/211 (37%)
Helicase_C 475..584 CDD:278689 50/112 (45%)
RH36NP_173078.1 SrmB 30..487 CDD:223587 145/382 (38%)
DEADc_DDX49 60..263 CDD:350713 77/210 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53695
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.