DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vas and DDX19A

DIOPT Version :9

Sequence 1:NP_001260458.1 Gene:vas / 26067080 FlyBaseID:FBgn0283442 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_060802.1 Gene:DDX19A / 55308 HGNCID:25628 Length:478 Species:Homo sapiens


Alignment Length:395 Identity:116/395 - (29%)
Similarity:199/395 - (50%) Gaps:52/395 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 NNIPVKVTGSDVPQP---IQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVI--SSGRDLMAC 288
            |...|:|...|...|   ::.|....|:..::..|...|:..|:.||:.::|::  ...::|:|.
Human    72 NTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQ 136

  Fly   289 AQTGSGKTAAFLLPILSKLLEDPHELELGRPQVVIVSPTRELAIQ---IFNEARKFAFESYLKIG 350
            :|:|:||||||:|.:||::  :|.:   ..||.:.:|||.|||:|   :..:..||..|  ||:.
Human   137 SQSGTGKTAAFVLAMLSRV--EPSD---RYPQCLCLSPTYELALQTGKVIEQMGKFYPE--LKLA 194

  Fly   351 IVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDR-TFITFEDTRFVVLDEADRML-DMGFSEDM 413
            ....|.......:...:   :||.|||.:||:..: .||..:..:..||||||.|: ..|..:..
Human   195 YAVRGNKLERGQKISEQ---IVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQS 256

  Fly   414 RRIMTHVTMRPEH-QTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKY-- 475
            .||.   .|.|.: |.|:|||||.:.:.:.|.:.:.:...:.:       ...::|:..:.:|  
Human   257 IRIQ---RMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKL-------KREEETLDTIKQYYV 311

  Fly   476 --AKRSKLIEILSE--------QADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQ 530
              :.|.:..:.|..        ||   ::|..|::.|.:||:.||::......:.|:.:..||..
Human   312 LCSSRDEKFQALCNLYGAITIAQA---MIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAA 373

  Fly   531 ALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKID------DYVHRIGRTGRVGNNGRA 589
            .:..|:.|..|||:.|:|.:||:|::.:..|||:|:|...|      .|:||||||||.|..|.|
Human   374 VIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLA 438

  Fly   590 TSFFD 594
            .:..|
Human   439 VNMVD 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vasNP_001260458.1 DEADc 247..454 CDD:238167 66/214 (31%)
DEXDc 260..467 CDD:214692 64/214 (30%)
Helicase_C 475..584 CDD:278689 40/126 (32%)
DDX19ANP_060802.1 N-terminal lobe. /evidence=ECO:0000250 2..299 71/246 (29%)
N-terminal helix. /evidence=ECO:0000250 54..67
DEAD-like_helicase_N 74..302 CDD:391939 70/247 (28%)
Q motif 91..119 6/27 (22%)
DEAD box 241..244 2/2 (100%)
C-terminal lobe. /evidence=ECO:0000250 300..478 45/147 (31%)
SF2_C_DEAD 306..442 CDD:350174 43/138 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.