DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment solo and DDX4

DIOPT Version :9

Sequence 1:NP_001027274.2 Gene:solo / 26067079 FlyBaseID:FBgn0283440 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_077726.1 Gene:DDX4 / 54514 HGNCID:18700 Length:724 Species:Homo sapiens


Alignment Length:281 Identity:66/281 - (23%)
Similarity:86/281 - (30%) Gaps:123/281 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDWDDE---------PIVDTRGARGGDWSDDEDTAKSFSGEAEGDGVGG-----SGGEGGGYQGG 53
            :||:.|         ||.: :....|:..|:.:...:.|.|.: ||...     ..|...|...|
Human     4 EDWEAEINPHMSSYVPIFE-KDRYSGENGDNFNRTPASSSEMD-DGPSRRDHFMKSGFASGRNFG 66

  Fly    54 NRDV----------------FGRIGGGRG--------GGAGGY--------------------RG 74
            |||.                .|:..|.||        |.:.|:                    ||
Human    67 NRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG 131

  Fly    75 GNRDGGGFHGG---RREGERDFRGGEGGF-----------------RGGQGGSR---------GG 110
            |.|||......   ||.|...|||..|||                 .||..|||         |.
Human   132 GYRDGNNSEASGPYRRGGRGSFRGCRGGFGLGSPNNDLDPDECMQRTGGLFGSRRPVLSGTGNGD 196

  Fly   111 QGGSRGGQGGFRGG---------------------EGGFRGRLYENEDAK-----ELPPIPSSCD 149
            ...||.|.|..|||                     |||      |:.|.:     .:||.|.. |
Human   197 TSQSRSGSGSERGGYKGLNEEVITGSGKNSWKSEAEGG------ESSDTQGPKVTYIPPPPPE-D 254

  Fly   150 KDEVGA-FIDQLDLSKYTTSL 169
            :|.:.| :...::..||.|.|
Human   255 EDSIFAHYQTGINFDKYDTIL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soloNP_001027274.2 None
DDX4NP_077726.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..246 56/249 (22%)
Interaction with RANBP9. /evidence=ECO:0000269|PubMed:27622290 228..247 5/24 (21%)
SrmB 260..>660 CDD:223587 5/16 (31%)
Q motif 288..316
DEAD box. /evidence=ECO:0000250|UniProtKB:Q61496 446..449
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..724
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D595675at2759
OrthoFinder 1 1.000 - - FOG0000634
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.