DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment solo and Ddx3y

DIOPT Version :9

Sequence 1:NP_001027274.2 Gene:solo / 26067079 FlyBaseID:FBgn0283440 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_001102328.1 Gene:Ddx3y / 364073 RGDID:1309586 Length:659 Species:Rattus norvegicus


Alignment Length:429 Identity:91/429 - (21%)
Similarity:145/429 - (33%) Gaps:127/429 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WSDDEDTAKSFSGEAEGDGVG------GSGGEGGGYQGGNRDVFGRIG--GGRGGGAGGYRGGNR 77
            ||.|:|...||...::.....      |||..|.....|..|..| :|  |||.|.....||||.
  Rat    60 WSKDKDAYSSFGSRSDTRAKSSFFSDRGSGSRGRFDDRGRSDYEG-VGSRGGRSGFGKFERGGNS 123

  Fly    78 ---DGGGFHGGRREGERDFRGGEGGFRGGQGGSRGGQGGSRGGQGGFRGGEGGFRGRLYEN---- 135
               |        :..|.|:             |:......|..|..|.||..|.....|::    
  Rat   124 RWCD--------KADEDDW-------------SKPLPPSERLEQELFSGGNTGINFEKYDDIPVE 167

  Fly   136 EDAKELPPIPSSCDKDEVGAFI-DQLDLSKYTT-------SLALIRKLRDYLLTAFKALVNQAWA 192
            ......||...|....|:|..| ..::|::||.       ::.:|::.||.:..|.......|..
  Rat   168 ATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAF 232

  Fly   193 SLEKLAQEKRAQKAHQIRETTDMMNRLMEDMGRLIREGE-----------------HEEANGIGM 240
            .|..|:|.........:        |.|::.|:..|..:                 :|||.  ..
  Rat   233 LLPILSQIYTDGPGEAL--------RAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEAR--KF 287

  Fly   241 GFQSIDADC----RADLSQWRNLQQVVMPQSSEIRDGQTN-----RTSG-----TEGGRSGGLTD 291
            .::|....|    .||:.|             :|||.:..     .|.|     .|.|:.|    
  Rat   288 SYRSRVRPCVVYGGADIGQ-------------QIRDLERGCHLLVATPGRLVDMMERGKIG---- 335

  Fly   292 GDDLTEIQSAAYAVYHQ---VLDRGYQTG-RRLYDDNQGALREDSIPTEDREHPENNQVDGSTYG 352
                  :....|.|..:   :||.|::.. ||:       :.:|::|.:...|   ..:..:|: 
  Rat   336 ------LDFCKYLVLDEADRMLDMGFEPQIRRI-------VEQDTMPPKGVRH---TMMFSATF- 383

  Fly   353 VTRFLHWLSENFVTRHEIRAV-RFGS-PHMVFQSYDWPE 389
             .:.:..|:.:|:..:...|| |.|| ...:.|...|.|
  Rat   384 -PKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soloNP_001027274.2 None
Ddx3yNP_001102328.1 eIF-4B 82..>170 CDD:283846 27/109 (25%)
DEADc 180..402 CDD:238167 47/266 (18%)
DEXDc 193..416 CDD:214692 49/267 (18%)
Helicase_C 424..534 CDD:278689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D595675at2759
OrthoFinder 1 1.000 - - FOG0000634
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.