DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment solo and Ddx3x

DIOPT Version :9

Sequence 1:NP_001027274.2 Gene:solo / 26067079 FlyBaseID:FBgn0283440 Length:1031 Species:Drosophila melanogaster
Sequence 2:XP_006256714.1 Gene:Ddx3x / 317335 RGDID:1564771 Length:662 Species:Rattus norvegicus


Alignment Length:471 Identity:96/471 - (20%)
Similarity:157/471 - (33%) Gaps:171/471 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KSFSG---EAEGDGVGGSGGEGGGY-----------------------QGGNRDVFGRIGGGRGG 67
            :.|:|   .:..:..|||....|.|                       ...::|.:...|.    
  Rat    14 QQFAGLDLNSSDNQTGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGS---- 74

  Fly    68 GAGGYRGGNRDGGGFHGGRREGER---DFRGGEGGFRGGQGGSRGGQGGSRGGQGGF-RGGEGGF 128
                 ||.:|....|.|.|..|.|   |.||     ||...|. ||: |.|.|.|.| |||...:
  Rat    75 -----RGDSRGKSSFFGDRGSGSRGRFDDRG-----RGDYDGI-GGR-GDRSGFGKFERGGNSRW 127

  Fly   129 RGRLYENEDAKELPP-----------------------IP-----SSCDKD-------EVGAFI- 157
            ..:..|::.:|.|||                       ||     ::|...       |:|..| 
  Rat   128 CDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIM 192

  Fly   158 DQLDLSKYTT-------SLALIRKLRDYLLTAFKALVNQAWASLEKLAQEKRAQKAHQIRETTDM 215
            ..::|::||.       ::.:|::.||.:..|.......|...|..|:|.........:      
  Rat   193 GNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGEAL------ 251

  Fly   216 MNRLMEDMGRLIREGE-----------------HEEANGIGMGFQSIDADC----RADLSQWRNL 259
              |.|::.||..|..:                 :|||.  ...::|....|    .|::.|    
  Rat   252 --RAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEAR--KFSYRSRVRPCVVYGGAEIGQ---- 308

  Fly   260 QQVVMPQSSEIRDGQTN-----RTSG-----TEGGRSGGLTDGDDLTEIQSAAYAVYHQ---VLD 311
                     :|||.:..     .|.|     .|.|:.|          :....|.|..:   :||
  Rat   309 ---------QIRDLERGCHLLVATPGRLVDMMERGKIG----------LDFCKYLVLDEADRMLD 354

  Fly   312 RGYQTG-RRLYDDNQGALREDSIPTEDREHPENNQVDGSTYGVTRFLHWLSENFVTRHEIRAV-R 374
            .|::.. ||:       :.:|::|.:...|   ..:..:|:  .:.:..|:.:|:..:...|| |
  Rat   355 MGFEPQIRRI-------VEQDTMPPKGVRH---TMMFSATF--PKEIQMLARDFLDEYIFLAVGR 407

  Fly   375 FGS-PHMVFQSYDWPE 389
            .|| ...:.|...|.|
  Rat   408 VGSTSENITQKVVWVE 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soloNP_001027274.2 None
Ddx3xXP_006256714.1 PTZ00110 57..580 CDD:240273 89/428 (21%)
DEADc_DDX3 160..410 CDD:350809 53/294 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D595675at2759
OrthoFinder 1 1.000 - - FOG0000634
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.