DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment solo and Ddx4

DIOPT Version :9

Sequence 1:NP_001027274.2 Gene:solo / 26067079 FlyBaseID:FBgn0283440 Length:1031 Species:Drosophila melanogaster
Sequence 2:XP_038958110.1 Gene:Ddx4 / 310090 RGDID:1308793 Length:733 Species:Rattus norvegicus


Alignment Length:292 Identity:69/292 - (23%)
Similarity:90/292 - (30%) Gaps:140/292 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DDWDDE----------PIVD----TRGARGGDWSDDEDTAKSFSGEAEGDGVGG-----SGGEGG 48
            :||:.|          |:.:    :.||.|    |..:...:.|.|.| ||..|     ..|...
  Rat     4 EDWEAEILKPHVSSYVPVFEKDKYSSGANG----DTFNRTSASSSEME-DGPSGRDHFMRSGFSS 63

  Fly    49 GYQGGNRDV-----------FGRIGGGRGGGAGGY------------------------------ 72
            |...||||:           .|..|.|:|.|..|:                              
  Rat    64 GRNLGNRDIGESSKRETTSTTGGFGRGKGFGNRGFLNNKFEEGDSSGFWKESTNDCEDTQTRSRG 128

  Fly    73 ---RGGNRDG------GGFHGGRREGERDFRGGEGGFRGG---------QGGSRGG--------- 110
               |||..||      |.|   ||.|...|||..|||..|         ||..|||         
  Rat   129 FSKRGGYPDGNDSEASGPF---RRGGRGSFRGCRGGFGLGRPNSEYDQDQGSQRGGGLFGSRKPA 190

  Fly   111 ---------------QGGSRGGQGGFRG-----------------GEGGFRGRLYENEDAK---- 139
                           |..|..|:||::|                 .|||      |:.|.:    
  Rat   191 ASDSVQCFTGSGDTFQSRSGNGRGGYKGLNEEVVTGSGKNSWKSEAEGG------ESSDIQGPKV 249

  Fly   140 -ELPPIPSSCDKDEVGA-FIDQLDLSKYTTSL 169
             .:||.|.. |:|.:.| :...::..||.|.|
  Rat   250 TYIPPPPPE-DEDSIFAHYQTGINFDKYDTIL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soloNP_001027274.2 None
Ddx4XP_038958110.1 DEADc_DDX4 262..514 CDD:350810 5/19 (26%)
SF2_C_DEAD 520..649 CDD:350174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D595675at2759
OrthoFinder 1 1.000 - - FOG0000634
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.