DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment solo and sum3

DIOPT Version :10

Sequence 1:NP_001027274.2 Gene:solo / 26067079 FlyBaseID:FBgn0283440 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_588033.1 Gene:sum3 / 2538689 PomBaseID:SPCC1795.11 Length:636 Species:Schizosaccharomyces pombe


Alignment Length:197 Identity:55/197 - (27%)
Similarity:76/197 - (38%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DEPIVDTRGARGGDWSDDEDTAKSFSGEAEGDGVGGSGGEGGGYQGGNRDVFGRIGGGRGGGAG- 70
            |:|......|.|    |||..:...|..::      :..|.....||.|: :.| ||..|||.| 
pombe    37 DKPSAGAAPAVG----DDESVSSRGSSRSQ------TPSEFSSNYGGRRE-YNR-GGHYGGGEGR 89

  Fly    71 --GYRGGNRDGGGFHGGRREGERDFRGGEGGFRGGQG--GSRGGQGGSRGGQGGFRGGEGGFRGR 131
              .|||| |:||..:||.....|.|    |.:|.||.  |:|... ..|...|....|.....|.
pombe    90 QNNYRGG-REGGYSNGGGYRNNRGF----GQWRDGQHVIGARNTL-LERQLFGAVADGTKVSTGI 148

  Fly   132 LYENEDAKELPPIPSSCDKDEVGAF---------IDQLDLSKYT-------TSLALIRKLRDYLL 180
            .:|..|  ::|...|..|.:.|..|         :..:.||.||       .|:.::...||.:.
pombe   149 NFEKYD--DIPVEVSGGDIEPVNEFTSPPLNSHLLQNIKLSGYTQPTPVQKNSIPIVTSGRDLMA 211

  Fly   181 TA 182
            .|
pombe   212 CA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soloNP_001027274.2 None
sum3NP_588033.1 SrmB 171..550 CDD:440279 9/43 (21%)

Return to query results.
Submit another query.