DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment solo and glh-2

DIOPT Version :9

Sequence 1:NP_001027274.2 Gene:solo / 26067079 FlyBaseID:FBgn0283440 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_491876.1 Gene:glh-2 / 172361 WormBaseID:WBGene00001599 Length:974 Species:Caenorhabditis elegans


Alignment Length:159 Identity:55/159 - (34%)
Similarity:63/159 - (39%) Gaps:31/159 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDDWDDEPIV--------DTRGARGGDWSDDEDTAKSFSGEAEGDGVGGSGGEGGGYQGGNRDV 57
            ||||||:....        :..|..||......:|....||.|.|.|.|.|...|.|: |||.:|
 Worm     1 MSDDWDNNTAAAKTISFGSNPSGFGGGSGFGSGNTGGFGSGNAGGTGFGSSNNGGSGF-GGNNNV 64

  Fly    58 FGRIGGGRGGGAG---------GYRGGNRDGGGFHGGRREGERDFRGGEGGFRGGQGGSRGGQG- 112
            ..|.|.|..||.|         |:..||..|.|| |....|...|..|..|..|..||:.||.| 
 Worm    65 GPRFGNGNAGGTGFGSGNAGGTGFGSGNAGGTGF-GSGNAGGTGFGSGNAGGTGFGGGNAGGTGF 128

  Fly   113 --GSRGGQG---------GFRGGEGGFRG 130
              |:.||.|         ||..|..|..|
 Worm   129 GSGNAGGTGLGSGNAGGTGFGSGNAGGTG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soloNP_001027274.2 None
glh-2NP_491876.1 Keratin_2_tail 69..177 CDD:292827 31/90 (34%)
zf-CCHC 257..274 CDD:278525
zf-CCHC 282..299 CDD:278525
zf-CCHC 371..388 CDD:278525
PTZ00368 373..508 CDD:173561
zf-CCHC 396..413 CDD:278525
PRK01297 459..924 CDD:234938
zf-CCHC 473..490 CDD:278525
DEADc 554..763 CDD:238167
Helicase_C 790..912 CDD:278689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D595675at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.