DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment solo and DDX3X

DIOPT Version :9

Sequence 1:NP_001027274.2 Gene:solo / 26067079 FlyBaseID:FBgn0283440 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_001347.3 Gene:DDX3X / 1654 HGNCID:2745 Length:662 Species:Homo sapiens


Alignment Length:442 Identity:96/442 - (21%)
Similarity:149/442 - (33%) Gaps:132/442 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TRGARGGD---WSD--DEDTAKSFSGEAEGDGVG------GSGGEGGGYQGGNRDVFGRIG--GG 64
            |:|....|   ||.  |:|...||...::..|..      |||..|.....|..|..| ||  |.
Human    49 TKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDG-IGSRGD 112

  Fly    65 RGGGAGGYRGGNRDGGGFHGGR---REGERDFRGGEGGFRGGQGGSRGGQGGSRGGQGGFRGGEG 126
            |.|.....||||        .|   :..|.|:             |:......|..|..|.||..
Human   113 RSGFGKFERGGN--------SRWCDKSDEDDW-------------SKPLPPSERLEQELFSGGNT 156

  Fly   127 GFRGRLYEN----EDAKELPPIPSSCDKDEVGAFI-DQLDLSKYTT-------SLALIRKLRDYL 179
            |.....|::    ......||...|....|:|..| ..::|::||.       ::.:|::.||.:
Human   157 GINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLM 221

  Fly   180 LTAFKALVNQAWASLEKLAQEKRAQKAHQIRETTDMMNRLMEDMGRLIREGE------------- 231
            ..|.......|...|..|:|.........:        |.|::.||..|..:             
Human   222 ACAQTGSGKTAAFLLPILSQIYSDGPGEAL--------RAMKENGRYGRRKQYPISLVLAPTREL 278

  Fly   232 ----HEEANGIGMGFQSIDADC----RADLSQWRNLQQVVMPQSSEIRDGQTN-----RTSG--- 280
                :|||.  ...::|....|    .||:.|             :|||.:..     .|.|   
Human   279 AVQIYEEAR--KFSYRSRVRPCVVYGGADIGQ-------------QIRDLERGCHLLVATPGRLV 328

  Fly   281 --TEGGRSGGLTDGDDLTEIQSAAYAVYHQ---VLDRGYQTG-RRLYDDNQGALREDSIPTEDRE 339
              .|.|:.|          :....|.|..:   :||.|::.. ||:       :.:|::|.:...
Human   329 DMMERGKIG----------LDFCKYLVLDEADRMLDMGFEPQIRRI-------VEQDTMPPKGVR 376

  Fly   340 HPENNQVDGSTYGVTRFLHWLSENFVTRHEIRAV-RFGS-PHMVFQSYDWPE 389
            |   ..:..:|:  .:.:..|:.:|:..:...|| |.|| ...:.|...|.|
Human   377 H---TMMFSATF--PKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVE 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soloNP_001027274.2 None
DDX3XNP_001347.3 Required for TBK1 and IKBKE-dependent IFNB1 activation. /evidence=ECO:0000269|PubMed:18636090 2..139 30/111 (27%)
Nuclear export signal. /evidence=ECO:0000269|PubMed:30131165, ECO:0000269|PubMed:31575075 12..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..144 30/116 (26%)
Interaction with EIF4E. /evidence=ECO:0000269|PubMed:17667941 38..44
PTZ00110 57..580 CDD:240273 93/434 (21%)
Interaction with VACV protein K7. /evidence=ECO:0000269|PubMed:19913487 81..90 0/8 (0%)
Involved in binding to RNA G-quadruplex. /evidence=ECO:0000269|PubMed:30256975 88..123 13/35 (37%)
Interaction with GSK3B. /evidence=ECO:0000269|PubMed:18846110 100..662 82/391 (21%)
Interaction with IKBKE 100..110 5/10 (50%)
Interaction with CHUK. /evidence=ECO:0000269|PubMed:17667941 139..172 7/32 (22%)
DEADc_DDX3 160..410 CDD:350809 55/294 (19%)
Q motif 180..208 7/27 (26%)
Involved in stimulation of ATPase activity by DNA and RNA, nucleic acid binding and unwinding and HIV-1 replication 250..259 2/16 (13%)
DEAD box 347..350 0/2 (0%)
Interaction with HCV core protein. /evidence=ECO:0000269|PubMed:10329544 409..662 5/15 (33%)
Interaction with NXF1. /evidence=ECO:0000269|PubMed:18596238 536..661
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 601..634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D595675at2759
OrthoFinder 1 1.000 - - FOG0000634
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.