DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment solo and Ddx3x

DIOPT Version :9

Sequence 1:NP_001027274.2 Gene:solo / 26067079 FlyBaseID:FBgn0283440 Length:1031 Species:Drosophila melanogaster
Sequence 2:NP_034158.1 Gene:Ddx3x / 13205 MGIID:103064 Length:662 Species:Mus musculus


Alignment Length:403 Identity:88/403 - (21%)
Similarity:142/403 - (35%) Gaps:136/403 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GYRGGNRDGGGFHGGRREGER---DFRGGEGGFRGGQGGSRGGQGGSRGGQGGF-RGGEGGFRGR 131
            |.||.:|....|.|.|..|.|   |.||     ||...|. ||: |.|.|.|.| |||...:..:
Mouse    73 GSRGDSRGKSSFFGDRGSGSRGRFDDRG-----RGDYDGI-GGR-GDRSGFGKFERGGNSRWCDK 130

  Fly   132 LYENEDAKELPP-----------------------IP-----SSCDKD-------EVGAFI-DQL 160
            ..|::.:|.|||                       ||     ::|...       |:|..| ..:
Mouse   131 SDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNI 195

  Fly   161 DLSKYTT-------SLALIRKLRDYLLTAFKALVNQAWASLEKLAQEKRAQKAHQIRETTDMMNR 218
            :|::||.       ::.:|::.||.:..|.......|...|..|:|.........:        |
Mouse   196 ELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGEAL--------R 252

  Fly   219 LMEDMGRLIREGE-----------------HEEANGIGMGFQSIDADC----RADLSQWRNLQQV 262
            .|::.||..|..:                 :|||.  ...::|....|    .|::.|       
Mouse   253 AMKENGRYGRRKQYPISLVLAPTRELAVQIYEEAR--KFSYRSRVRPCVVYGGAEIGQ------- 308

  Fly   263 VMPQSSEIRDGQTN-----RTSG-----TEGGRSGGLTDGDDLTEIQSAAYAVYHQ---VLDRGY 314
                  :|||.:..     .|.|     .|.|:.|          :....|.|..:   :||.|:
Mouse   309 ------QIRDLERGCHLLVATPGRLVDMMERGKIG----------LDFCKYLVLDEADRMLDMGF 357

  Fly   315 QTG-RRLYDDNQGALREDSIPTEDREHPENNQVDGSTYGVTRFLHWLSENFVTRHEIRAV-RFGS 377
            :.. ||:       :.:|::|.:...|   ..:..:|:  .:.:..|:.:|:..:...|| |.||
Mouse   358 EPQIRRI-------VEQDTMPPKGVRH---TMMFSATF--PKEIQMLARDFLDEYIFLAVGRVGS 410

  Fly   378 -PHMVFQSYDWPE 389
             ...:.|...|.|
Mouse   411 TSENITQKVVWVE 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soloNP_001027274.2 None
Ddx3xNP_034158.1 Required for TBK1 and IKBKE-dependent IFNB1 activation. /evidence=ECO:0000250|UniProtKB:O00571 2..139 26/72 (36%)
Nuclear export signal. /evidence=ECO:0000250|UniProtKB:O00571 12..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..144 30/77 (39%)
Interaction with EIF4E. /evidence=ECO:0000250|UniProtKB:O00571 38..44
PTZ00110 57..580 CDD:240273 88/403 (22%)
eIF-4B 80..>172 CDD:283846 28/98 (29%)
Interaction with GSK3B. /evidence=ECO:0000250|UniProtKB:O00571 100..662 77/376 (20%)
Interaction with IKBKE. /evidence=ECO:0000250|UniProtKB:O00571 100..110 5/15 (33%)
Interaction with CHUK. /evidence=ECO:0000250|UniProtKB:O00571 139..172 5/32 (16%)
Q motif 180..208 6/27 (22%)
DEADc 182..404 CDD:238167 47/266 (18%)
Involved in stimulation of ATPase activity by DNA and RNA, nucleic acid binding and unwinding. /evidence=ECO:0000250|UniProtKB:O00571 250..259 2/16 (13%)
DEAD box 347..350 0/2 (0%)
Helicase_C 426..536 CDD:278689
Interaction with NXF1. /evidence=ECO:0000250|UniProtKB:O00571 536..661
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 601..633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D595675at2759
OrthoFinder 1 1.000 - - FOG0000634
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.