DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdicC and Dnai2

DIOPT Version :9

Sequence 1:NP_001303578.1 Gene:SdicC / 26067076 FlyBaseID:FBgn0283434 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001261723.1 Gene:Dnai2 / 39318 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster


Alignment Length:456 Identity:106/456 - (23%)
Similarity:184/456 - (40%) Gaps:82/456 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KEVNELSEEQ----KQMIILSENFQRFVVRAGRVIERALSEN--VDIYTDYIGGGDSEEANDERS 175
            |::|....||    |:.|...||:...|:...:.:|..:.:|  |:||.:|....|.... .|..
  Fly    80 KDINMHDPEQTVRYKRKIEKDENYITQVMNLTKPMEHYIHQNNAVNIYENYFENLDPAPL-PEPC 143

  Fly   176 HARLSLNRVFYDERWSKNRCITSMDWS---------THFPKLVVGSYHNNE--------ESPNEP 223
            .:| ::| |:.|....|.. :..:.||         :|......|...|.:        |:||||
  Fly   144 KSR-TVN-VYRDPNPIKVP-VKHLSWSPDGGIKMAVSHCDMRFQGDKSNQKCNSYIWEVENPNEP 205

  Fly   224 DGVVMVWNTKFKKSTPEDVFHCQSAVMSTC--FAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQR 286
                      |....|:        |...|  :.:.:|..::.|.|:||:..||.| ..:.|:..
  Fly   206 ----------FLTLEPK--------VPCVCLEYNQKDPTSLVSGMYNGQVAAWDTR-HGKLPVMI 251

  Fly   287 TPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTLEL------QQRQSKA 345
            :. ....|..||..:....:::.....|..|||::..|....|::|.|.|.:      .|..|::
  Fly   252 SE-REVCHRDPVNSVLWNNSKSGTEFFSGGSDGQVLWWDTRKLTEPLDRLLMDPVKSDDQDLSRS 315

  Fly   346 IAITSMAFPANEINSLVMGSEDGYVYSASRHGLRSGVNEVYER---HLGPITGISTHYNQLSPDF 407
            ..|:.:.:........:.|:|.|.::|.:|.| ::...::..|   ||||:..|:.     :|.|
  Fly   316 YGISVLEYETTIPTRFMAGTEMGMLFSCNRKG-KTPTEKIQIRMMCHLGPVYAITR-----NPAF 374

  Fly   408 GHLFLTSS---IKIWSLKLPISSCQFSVVSGINSNKPLYSFEDNSDYMMDVAWSPVHPALFAAVD 469
            ...|||..   .:|||     ..|:.|.:....|         :|..:.|.|||....:.|....
  Fly   375 VKNFLTVGDWCARIWS-----EDCRESSIIWTKS---------SSSMLTDGAWSYTKVSQFFITR 425

  Fly   470 GSGRLDLWNLNQDTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRD 534
            ..|.||.|:|.|....|..::.|...| |..|....:|..|..|.:.|..::.:|::|:...:::
  Fly   426 MDGVLDTWDLLQQQNEPVLTVKVCDEP-LYCVRTNENGKFVSCGSQLGATFLVEVSDNMVMSAKN 489

  Fly   535 E 535
            :
  Fly   490 D 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdicCNP_001303578.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 17/66 (26%)
WD40 196..523 CDD:295369 82/357 (23%)
WD40 repeat 196..245 CDD:293791 12/65 (18%)
WD40 <224..534 CDD:225201 74/323 (23%)
WD40 repeat 251..289 CDD:293791 10/39 (26%)
WD40 repeat 298..337 CDD:293791 9/38 (24%)
WD40 repeat 349..386 CDD:293791 6/36 (17%)
WD40 repeat 393..446 CDD:293791 12/55 (22%)
WD40 repeat 452..491 CDD:293791 12/38 (32%)
WD40 repeat 498..522 CDD:293791 6/23 (26%)
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 83/363 (23%)
WD40 repeat 162..208 CDD:293791 11/55 (20%)
WD40 212..469 CDD:295369 68/287 (24%)
WD40 repeat 215..254 CDD:293791 10/40 (25%)
WD40 repeat 262..304 CDD:293791 10/41 (24%)
WD40 repeat 318..355 CDD:293791 7/37 (19%)
WD40 repeat 365..401 CDD:293791 11/45 (24%)
WD40 repeat 408..433 CDD:293791 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.