DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdicC and CG15701

DIOPT Version :9

Sequence 1:NP_001303578.1 Gene:SdicC / 26067076 FlyBaseID:FBgn0283434 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_611100.1 Gene:CG15701 / 36801 FlyBaseID:FBgn0034095 Length:1051 Species:Drosophila melanogaster


Alignment Length:567 Identity:102/567 - (17%)
Similarity:176/567 - (31%) Gaps:207/567 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 STGGGNGDVLAFDAQG---DDEESSLQNLGNGFTSKLPPGY-----LTHGLPTVKDVAPAITPLE 108
            |.|..|...:|...|.   |.|..:|:.......::.||.|     |:..:....|...:..|.:
  Fly   415 SYGKLNASQVATQTQSPHMDGECQTLEVHSRSSWTQHPPHYGGQFVLSCSVDAELDETWSKQPAD 479

  Fly   109 IKKETEVKK--EVNELSEEQKQMIILS--------ENFQRFVVRAGRVIERALS----------- 152
             :.|..:.:  :::.|.:.:.|.:...        |....|:.||||::...|.           
  Fly   480 -EYEASISRLEQLHRLEQARSQQLQQKRLAKSTDLERLNSFLHRAGRLMGLVLEGKTTAHGQGNS 543

  Fly   153 -ENVDIYTDYIGGGDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPKLVVGSYHNN 216
             .||.:.|..:..              |.:.|:|                         ||..|.
  Fly   544 PRNVPLQTGLLNA--------------LPVRRIF-------------------------GSAGNG 569

  Fly   217 E------ESPNEPD-------GVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYS 268
            :      |.|.:.:       .::|||:.. ..|.|..:....:.|.....:....::::.|...
  Fly   570 QLVVTVHECPADSNVYKEDFASLLMVWSLA-NPSQPLRLLSTWAEVSRVALSAQAQDIVVAGLRD 633

  Fly   269 GQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQ 333
            |.:.:||.|                .||. ||.::              ||.|..:     :..|
  Fly   634 GSVAMWDLR----------------ETHS-YCSKL--------------DGHLTHF-----AATQ 662

  Fly   334 DTLELQQRQSKAIAITSMAFPANEINSLVMGS-----------EDGYVYSASRHGLRSGVNEVYE 387
            ..:.:.::|.|            |:|::.:|:           ..|.|  |:..||::...||..
  Fly   663 SVVPMPEQQDK------------EVNAMDLGAVVDVRSFRSHLNAGGV--AATSGLQTTYKEVQY 713

  Fly   388 RHL---GPIT-------GISTHYNQLSPDFGHLFLTSSIKIWSLKLPISSCQF----------SV 432
            ..|   |.:|       ..||:.|:.|..:..:.|..|          .||..          |.
  Fly   714 ASLNDSGLLTMWTLVEGASSTNSNEFSSPWARVKLLQS----------GSCDLRSYLERRLLKSH 768

  Fly   433 VSGINSNKPLYSFEDNSDYMMDVAWSPVHPALFAAVDGSGRLDLWNLNQDTEVPTASIVVAGAPA 497
            .|.....|.|:.....||   ||                    |..|| ||:..|.::...|...
  Fly   769 QSAYEKTKSLFQGNIYSD---DV--------------------LRELN-DTQTLTTALQGQGLQG 809

  Fly   498 LNRVSWTPSG---LHVCIGDEAGKLYVYDVAENLAQPSRDEIKMNQS 541
            | |.:...:|   ::||    ..:.:|.....:|.......|.:|:|
  Fly   810 L-RFTSIDTGSELIYVC----TNRNFVLCCTRSLKTERFARIAVNES 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdicCNP_001303578.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 13/91 (14%)
WD40 196..523 CDD:295369 68/373 (18%)
WD40 repeat 196..245 CDD:293791 10/61 (16%)
WD40 <224..534 CDD:225201 64/350 (18%)
WD40 repeat 251..289 CDD:293791 5/37 (14%)
WD40 repeat 298..337 CDD:293791 6/38 (16%)
WD40 repeat 349..386 CDD:293791 9/47 (19%)
WD40 repeat 393..446 CDD:293791 13/69 (19%)
WD40 repeat 452..491 CDD:293791 8/38 (21%)
WD40 repeat 498..522 CDD:293791 5/26 (19%)
CG15701NP_611100.1 PTZ00108 <23..270 CDD:240271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.