DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdicC and CG1571

DIOPT Version :9

Sequence 1:NP_001303578.1 Gene:SdicC / 26067076 FlyBaseID:FBgn0283434 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_572435.1 Gene:CG1571 / 31725 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster


Alignment Length:461 Identity:108/461 - (23%)
Similarity:183/461 - (39%) Gaps:82/461 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KEVNELSEEQKQMIILSENFQRFVVRAGRVIERALS------------ENVDIYTDYIGGGDSEE 169
            ||||...|||.|      ..::.|.|.....|:.||            ..::||.::......|.
  Fly    83 KEVNFNDEEQTQ------RHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLNIYQNFFADLPPEL 141

  Fly   170 ANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPKLVVGSYHNN-------EESPNEPDGVV 227
            .:|.:...|..:..||:| .|...|.:.|::|..:..:..:..|.|:       ....:||.|..
  Fly   142 GHDIKMRFRARVANVFHD-LWLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPFGGT 205

  Fly   228 ---MVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPL 289
               .||:.| ....|...:..:..|........:.|.::|||..||:.|| ...:...||:..||
  Fly   206 NGFYVWDVK-NPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLW-GTFKGGLPIRNCPL 268

  Fly   290 SAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTL----ELQQRQSK--AIAI 348
            . .:|......|..|.:::.....|.|.||.:..|....|..|...|    |.|:|||:  :..:
  Fly   269 E-VSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSHGV 332

  Fly   349 TSMAFPANEINSLVMGSEDGYVYSASRHGL--RSGVNEVYERHLGPITGISTHYNQLSPDFGHLF 411
            |.:.|........::||:.|:|:..:|.|:  ...:...|:..:||:..|:.     :|.|...|
  Fly   333 TVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINR-----NPFFVKNF 392

  Fly   412 LTSS---IKIWSLKLPISSCQFSVVSGINSNKPLYSFEDNSDYMMDVAWSPVHPALFAAVDGSGR 473
            |.:.   .:|||.::.            :|...:| |..|:..:.. |||....:||...|.:|.
  Fly   393 LVTGDWRARIWSEEVK------------DSPSTMY-FRKNAQILCG-AWSTGRCSLFVTGDINGV 443

  Fly   474 LDLWNL---------NQDTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLA 529
            :|.|:|         :.|.:|..|.:|           :.|.|..:.||.:.|..::..:.|::.
  Fly   444 VDFWDLLLHHRKPIRSVDFKVAIADLV-----------FRPEGDLLAIGLKNGDTHIMTLDESMR 497

  Fly   530 QPSRDE 535
            |.:..|
  Fly   498 QATGKE 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdicCNP_001303578.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 17/72 (24%)
WD40 196..523 CDD:295369 82/356 (23%)
WD40 repeat 196..245 CDD:293791 11/58 (19%)
WD40 <224..534 CDD:225201 78/332 (23%)
WD40 repeat 251..289 CDD:293791 10/37 (27%)
WD40 repeat 298..337 CDD:293791 10/42 (24%)
WD40 repeat 349..386 CDD:293791 8/38 (21%)
WD40 repeat 393..446 CDD:293791 10/55 (18%)
WD40 repeat 452..491 CDD:293791 13/47 (28%)
WD40 repeat 498..522 CDD:293791 5/23 (22%)
CG1571NP_572435.1 WD40 210..462 CDD:295369 66/273 (24%)
WD40 211..>488 CDD:225201 74/309 (24%)
WD40 repeat 229..269 CDD:293791 12/40 (30%)
WD40 repeat 277..325 CDD:293791 13/47 (28%)
WD40 repeat 332..369 CDD:293791 8/36 (22%)
WD40 repeat 379..415 CDD:293791 9/52 (17%)
WD40 repeat 422..447 CDD:293791 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435281
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.