DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SdicB and PFS2

DIOPT Version :9

Sequence 1:NP_001303577.1 Gene:SdicB / 26067075 FlyBaseID:FBgn0283433 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_014082.1 Gene:PFS2 / 855399 SGDID:S000005261 Length:465 Species:Saccharomyces cerevisiae


Alignment Length:364 Identity:78/364 - (21%)
Similarity:137/364 - (37%) Gaps:63/364 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VIERALSENVDIYTDYIGGGDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVV 210
            |:|...|..:||.......|.....|.......||.|:|        ...|.::.|:.....|||
Yeast    54 VVEPETSYTIDIMPPNAYRGRDRVINLPSKFTHLSSNKV--------KHVIPAIQWTPEGRRLVV 110

  Fly   211 GSYHNNEESPNEPDGVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWD 275
            .:|          .|...:||.  ...|.|.:.....:.::|.....:.:.::.|...|.|.:|.
Yeast   111 ATY----------SGEFSLWNA--SSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQ 163

  Fly   276 NRVQKRTPIQRTPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTLELQQ 340
            ........|.      ||||..:  ..|..:.|....::.|.|..|..|:..           ..
Yeast   164 PNFSMVKEID------AAHTESI--RDMAFSSNDSKFVTCSDDNILKIWNFS-----------NG 209

  Fly   341 RQSKAIAITSMAFPANEINSLVMGSEDGYVYSASRHGL------RSG--VNEVYE-RHLGPITGI 396
            :|.:.::....     ::.|.....|.|.:.|||:..|      |||  ::.:.: :|    |.:
Yeast   210 KQERVLSGHHW-----DVKSCDWHPEMGLIASASKDNLVKLWDPRSGNCISSILKFKH----TVL 265

  Fly   397 STHYNQLSPDFGHLFLTSSIDWTIKLWSLK-DTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGS 460
            .|.:   .|..|:|.:..|.|.:.:::.:: ..|.|....|.:|| |.:.|.|::.::|......
Yeast   266 KTRF---QPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDETDY-MTLEWHPINESMFTLACYD 326

  Fly   461 GRLDLWNLNQDTEVPIASIVVAGAPALNRVSWTPSGLHV 499
            |.|..::|.|:...||.:|..|....:..:|:.|.| |:
Yeast   327 GSLKHFDLLQNLNEPILTIPYAHDKCITSLSYNPVG-HI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdicBNP_001303577.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 7/31 (23%)
WD40 196..512 CDD:295369 67/314 (21%)
WD40 repeat 196..245 CDD:293791 11/48 (23%)
WD40 <224..523 CDD:225201 61/286 (21%)
WD40 repeat 251..289 CDD:293791 6/37 (16%)
WD40 repeat 298..337 CDD:293791 6/38 (16%)
WD40 repeat 349..435 CDD:293791 20/95 (21%)
WD40 repeat 441..479 CDD:293791 10/37 (27%)
WD40 repeat 487..513 CDD:293791 4/13 (31%)
PFS2NP_014082.1 WD40 93..377 CDD:238121 67/317 (21%)
WD40 repeat 98..133 CDD:293791 10/46 (22%)
WD40 repeat 139..175 CDD:293791 6/41 (15%)
WD40 repeat 180..216 CDD:293791 7/48 (15%)
WD40 repeat 223..257 CDD:293791 10/33 (30%)
WD40 repeat 264..299 CDD:293791 7/37 (19%)
WD40 repeat 307..346 CDD:293791 11/39 (28%)
WD40 repeat 353..377 CDD:293791 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.