DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fatp1 and CG4563

DIOPT Version :9

Sequence 1:NP_001162940.3 Gene:Fatp1 / 26067068 FlyBaseID:FBgn0267828 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_611913.1 Gene:CG4563 / 37901 FlyBaseID:FBgn0035006 Length:537 Species:Drosophila melanogaster


Alignment Length:504 Identity:108/504 - (21%)
Similarity:195/504 - (38%) Gaps:85/504 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 NYTVADVFERNVQAHPDKVAVVSETQRWTFRQVN--EHANKVANVLQAQGYKKGDVVALLLENRA 237
            |.:|..:...:::..|..|..:::.........:  .:|.::|...:::|..:.|.|. ::.|.:
  Fly    30 NTSVGQIVFNSLRCWPTNVIQITDDDGTVLTNADMLAYATRIALFFKSEGLTQEDRVG-IIANSS 93

  Fly   238 EYVATWLGLSKIGVITPLINTNL-RGPSL---LHSITVAHCSALIYGEDFLEAVTDVAKD-LPAN 297
            .:|.. :..:.....||....|. |.|::   |:|:|.... ..|.|.|: :.:.::.|: .|..
  Fly    94 TFVIP-VATACFFQATPFHAVNYSREPAIVQGLYSVTKPKI-MFIDGPDY-DRIKEITKEWSPKL 155

  Fly   298 LTLFQFNNENNNSETEKNIPQAKNLNALLTTASYEK---PNKTQVNHHDKLVYIYTSGTTGLPKA 359
            :||           |.| :....::..|:.....||   |...........|.:.:|||.|||||
  Fly   156 ITL-----------TGK-VEGVTSIEDLVKPHPAEKIYVPASLATGGDQIAVVLCSSGTAGLPKA 208

  Fly   360 AVISHSRYLFIAAGIHYTMGFQEEDIFYTPLPL-YHTAGGIMCMGQSVLFGSTVSIRKKFSASNY 423
            ..:|| |::.....:..:     .|:.||...: :.|...|..|..:..|...:| |:.|||...
  Fly   209 VALSH-RHIASTNSLCIS-----TDVLYTSATIDWMTGFSITVMNLTCGFTRIIS-RRTFSAETA 266

  Fly   424 FADCAKYNATIGQYIGEMARYILATKP---SEYDQKHRVRLVFGNGL-------RPQIWPQFVQR 478
            ....:||..|. ..:.....|.|.|.|   ||..:..::..|.|..:       ..::.|:....
  Fly   267 LYLVSKYKVTC-LAMAPWQAYELFTSPLATSEQLESLKIAFVIGGWISLALLRRAQELLPKTYVM 330

  Fly   479 FNIAKVGEFYGATEGNANIMNHDNTVGAIGFVSRILPKIYPISIIRADPDTGEPIRDRNGLCQLC 543
            |:       ||.||.....:|.|:::              ..|:.|..|.....|:..:|  |..
  Fly   331 FS-------YGTTETGVVTINIDHSL--------------ECSVGRLAPGMRIKIQGEDG--QQL 372

  Fly   544 APNEPGVFIGKIVKGNPSREFLGYVDEKASAKKIVKDVFKHGDMAFIS-GDLLVADEKGYLYFKD 607
            ..|:.|..:..|     ..::.||:.........::|       .:|: |||...||...||..|
  Fly   373 GVNQTGEVLIDI-----GLKWEGYLSNPEDTATTLQD-------GWINLGDLGYFDEDNNLYLVD 425

  Fly   608 RTGDTFRWKGENVSTSEVEAQVSNVAGYKDTVVYGVTIPHTEGRAGMAA 656
            |..|..::|.::...:|:|..::.:...:...|.||    .:.|.|.||
  Fly   426 RKKDLLKYKSKHYWPNEIEQIIAELPEVEHVCVVGV----RDARYGDAA 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fatp1NP_001162940.3 PRK08279 153..746 CDD:236217 108/504 (21%)
hsFATP4_like 199..712 CDD:213305 104/480 (22%)
CG4563NP_611913.1 CaiC 21..531 CDD:223395 108/504 (21%)
Firefly_Luc_like 49..521 CDD:213279 104/485 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.