DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRAS40 and Akt1s1

DIOPT Version :9

Sequence 1:NP_001303349.1 Gene:PRAS40 / 26067067 FlyBaseID:FBgn0267824 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_038960764.1 Gene:Akt1s1 / 292887 RGDID:1312049 Length:277 Species:Rattus norvegicus


Alignment Length:237 Identity:57/237 - (24%)
Similarity:93/237 - (39%) Gaps:49/237 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 VGNSPTFRQQSAAG----GAGGPPTQTLTPNGV---GQSSVNEDADDCLFDLEDV---------- 415
            ||.:..||.::...    .|..||.....|...   |:.::.|.|..||.|:...          
  Rat    34 VGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIAQAHRAATATRPP 98

  Fly   416 -DAPVPVQSVPVPSY-TRSLIYQQQPQHNPFQQLSQQ----------NGLRSVLDDEAA------ 462
             ..|.|....|.||. .|..:.:::.:.:..:....:          ||...::|::|.      
  Rat    99 GPPPAPQPPSPAPSSPPRPALAREEDEEDEDEPTETETSGERLGGSDNGGLFMMDEDATLQDLPP 163

  Fly   463 -DEAEDALDPDSSIS--IPVRGGGRPSHAQL-------MNFARSLPIEIANTTLAERAAVANNNN 517
             .|::.....|.|:|  .|   .|.|::.:|       ..:|:|||:.:......|:...|.:::
  Rat   164 FCESDPESTDDGSLSEETP---AGPPAYPKLPATALPTQQYAKSLPVSVPVWAFKEKRTEARSSD 225

  Fly   518 FGQGCEEGMDNIDIAASIQALT-RSVHGEAVFGDLPRPRLRS 558
            ...|.....|...||||::||. |......||||||||||.:
  Rat   226 EENGPPSSPDLDRIAASMRALVLREAEDNQVFGDLPRPRLNT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRAS40NP_001303349.1 PRAS <472..556 CDD:292426 30/93 (32%)
Akt1s1XP_038960764.1 PRAS 148..272 CDD:406279 35/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336666
Domainoid 1 1.000 42 1.000 Domainoid score I12143
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009554
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21844
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.