DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmc and Tmc4

DIOPT Version :9

Sequence 1:NP_001303362.1 Gene:Tmc / 26067066 FlyBaseID:FBgn0267796 Length:2036 Species:Drosophila melanogaster
Sequence 2:NP_001029276.1 Gene:Tmc4 / 308310 RGDID:1304811 Length:698 Species:Rattus norvegicus


Alignment Length:236 Identity:73/236 - (30%)
Similarity:120/236 - (50%) Gaps:17/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1237 CWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFPQYGDFKIAENILT 1301
            ||||.||||:.|:::||.||.::..|.|.|.|.:..     ..|...........:|::.:.:|.
  Rat   461 CWETRLGQEMYKLVLFDLLMGLLVTLLIQFPRKILC-----GLCPGALGRLSGTLEFQVPDEVLG 520

  Fly  1302 LINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKASKSNNFYLSLLLTML 1366
            ||..|..||:|.||.|.|.|||..|.:|:.:.:...:.:...|....|:||.:|.|:..:||..|
  Rat   521 LIYAQTVVWVGSFFCPLLPLINTAKFLILFWLKKITLFSIYSPASRTFRASTANFFFPLVLLVGL 585

  Fly  1367 FLCVLPVGYAIVWLRPSWHCGPF----SEYNRIAEFITNTTRNALPKQLHEPLDYLTSSSTVIPL 1427
            .:..:||.|:|..:.||..||||    |.:.:|.|.|     .:||:.....|.:|.:.:..:||
  Rat   586 AISAVPVLYSIFLIPPSKLCGPFQGKLSIWAQIPESI-----ESLPQTAQNFLYFLGTQAFTVPL 645

  Fly  1428 LLLLILIIYYLVSLTGALREANQDLRTQLQKEREEERKKIF 1468
            |::..:::.|.|:|.........:|:.|::   .|.:.|:|
  Rat   646 LIVSSILMMYTVALANCYGRLISELKRQIE---TEVQNKVF 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TmcNP_001303362.1 TMC 1242..1348 CDD:285101 32/105 (30%)
DUF612 <1447..1844 CDD:282585 5/22 (23%)
Tmc4NP_001029276.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..104
RSN1_7TM <371..>439 CDD:280815
TMC 466..566 CDD:285101 32/104 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.