DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmc and Tmc6

DIOPT Version :9

Sequence 1:NP_001303362.1 Gene:Tmc / 26067066 FlyBaseID:FBgn0267796 Length:2036 Species:Drosophila melanogaster
Sequence 2:NP_663414.3 Gene:Tmc6 / 217353 MGIID:1098686 Length:810 Species:Mus musculus


Alignment Length:345 Identity:89/345 - (25%)
Similarity:140/345 - (40%) Gaps:94/345 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1209 LTPLERKQKRLKEVQLAI--------------------KQIQTNLTTMCWETSLGQELSKVIVFD 1253
            |..|||....:.||.:||                    :::.| |...|||..:||||.:.:|.|
Mouse   492 LATLERHDSPVLEVYMAICRNLILKMAVLGVLCYHWLGRRVAT-LQGQCWEDFVGQELYRFMVVD 555

  Fly  1254 GLMSIVAPLCIDFLRALFVRYVNQNWCWDMEKTFP--QYGDFKIAENILTLINNQGQVWMGIFFS 1316
            .:..:        |.:||...|   |....||...  |..:|.||.|:|.||..|...|:|:.||
Mouse   556 FIFML--------LDSLFGELV---WRLISEKKLKRGQKPEFDIARNVLDLIYGQTLTWLGVLFS 609

  Fly  1317 PGLVLINLVKLMIMMYF-RSWIVLTCNVPHEVVFKASKSNNFYLSLLL------TMLFLCVLPVG 1374
            |.|..:.:::|:.:.:. ::.::..|..|.. .:.||..:..:|:||.      ..:|||     
Mouse   610 PLLPAVQILRLLFLFHIKKASLMANCQAPRR-PWLASHMSTVFLTLLCFPSFLGAAVFLC----- 668

  Fly  1375 YAIVWLRPSWHCGPFSEYNRIAEFITNTTRNALPKQLHEPLDYLTSSSTVIPLL----------- 1428
            ||:..:|||..||||...|.:.|..|...|.         |::..|.::.:|.|           
Mouse   669 YAVWQVRPSSTCGPFRTLNTMYEAGTVWVRR---------LEHAGSGASWLPWLHHFLVENTFFL 724

  Fly  1429 ----LLLILIIYYLVSLTGALREANQDLRTQLQKEREEERKKIFKVPEVKQAEPTATTLTNRWRK 1489
                .||:.:||:.:.:....|:....|:.|::.|.|:   |||              |.|:...
Mouse   725 FLASALLLAVIYFNIQVVKGQRKVICLLKEQIRNEGED---KIF--------------LINKLHS 772

  Fly  1490 VLEASSPVTP------TQPP 1503
            |.|......|      |:||
Mouse   773 VYEEEGRSRPGRTQDTTEPP 792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TmcNP_001303362.1 TMC 1242..1348 CDD:285101 31/108 (29%)
DUF612 <1447..1844 CDD:282585 15/63 (24%)
Tmc6NP_663414.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
TMC 539..645 CDD:369533 34/117 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 775..810 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.