DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmc and TMC8

DIOPT Version :9

Sequence 1:NP_001303362.1 Gene:Tmc / 26067066 FlyBaseID:FBgn0267796 Length:2036 Species:Drosophila melanogaster
Sequence 2:XP_024306385.1 Gene:TMC8 / 147138 HGNCID:20474 Length:738 Species:Homo sapiens


Alignment Length:283 Identity:80/283 - (28%)
Similarity:130/283 - (45%) Gaps:38/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1237 CWETSLGQELSKVIVFDGLMSIVAPLCIDFLRALFV-RYVNQNWCWDMEKTFPQYGDFKIAENIL 1300
            |||.|:|:||.|:.:|:.|:::.....:...|.|.| |:..:.|.| :|:.     :|.:.:|:|
Human   422 CWENSVGEELYKLSIFNFLLTVAFAFLVTLPRRLLVDRFSGRFWAW-LERE-----EFLVPKNVL 480

  Fly  1301 TLINNQGQVWMGIFFSPGLVLINLVKLMIMMYFRSWIVLTCNVPHEVVFKASKSNNFYLSLLLTM 1365
            .::..|...|||:|:.|.|.|:|.|.|.:..|.:.:.:|..:......|:||.|..|:..:||..
Human   481 DIVAGQTVTWMGLFYCPLLPLLNSVFLFLTFYIKKYTLLKNSRASSRPFRASSSTFFFQLVLLLG 545

  Fly  1366 LFLCVLPVGYAI---VW-----LRPSWHCGPFSEYNRIAEFITNTTRNALPKQLHEPLDYLTSSS 1422
            |.|..:|:||.:   .|     :..||.||.|:.|:...:.:.......||......|.||.|.:
Human   546 LLLAAVPLGYVVSSPTWPSLASIHSSWDCGLFTNYSAPWQVVPELVALGLPPIGQRALHYLGSHA 610

  Fly  1423 TVIPLLLLLILIIYYLVSLTGALREANQDLRTQLQKEREEERKKIFKVPEVKQAEPTATTLTNRW 1487
            ...|||::|.|::...||.|.|...|...||.||          :::|.|             :|
Human   611 FSFPLLIMLSLVLTVCVSQTQANARAIHRLRKQL----------VWQVQE-------------KW 652

  Fly  1488 RKVLEASSPVTPTQPPDFDTEEY 1510
            ..|.:.|..:....|.|....:|
Human   653 HLVEDLSRLLPEPGPSDSPGPKY 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TmcNP_001303362.1 TMC 1242..1348 CDD:285101 29/106 (27%)
DUF612 <1447..1844 CDD:282585 13/64 (20%)
TMC8XP_024306385.1 TMC 422..532 CDD:311658 34/115 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.