DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46026 and AT3G28790

DIOPT Version :9

Sequence 1:NP_001303496.1 Gene:CG46026 / 26067064 FlyBaseID:FBgn0267690 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_189521.1 Gene:AT3G28790 / 822511 AraportID:AT3G28790 Length:608 Species:Arabidopsis thaliana


Alignment Length:455 Identity:104/455 - (22%)
Similarity:202/455 - (44%) Gaps:45/455 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KWRRR-----------------RTSTRLPTTVTSDPASTGSPTTSTTIPTTTGSSTTSTAIPTST 161
            ||.|.                 .:|..|...|.:...|:.....|::....:.|:|.|....:.:
plant   158 KWTRMVITFVKSVAEKRGKSIDESSYGLDVDVNASIGSSSGSDGSSSSDNESSSNTKSQGTSSKS 222

  Fly   162 GSPTTSTAIPTTTGSPT------TSTAIPTSTEPATTSTAIPTSTGSPTTSTAIPTSTGSPTTSP 220
            ||.:|:.:|.|.|||.|      :|:|........::......:|||  :|.|.|  :||||.:|
plant   223 GSESTAGSIETNTGSKTEAGSKSSSSAKTKEVSGGSSGNTYKDTTGS--SSGASP--SGSPTPTP 283

  Fly   221 AIPT-STTTTQTPIPTSTTTTTESSTTSTAIPPSTTTTTESSTTSTAIPTSTTTTTASSTTSTAI 284
            :.|| ||.|..||.|::.|.:|.:.:|.....|:...|:|..:.|.::...:.:.:.|.:.::..
plant   284 STPTPSTPTPSTPTPSTPTPSTPTPSTPAPSTPAAGKTSEKGSESASMKKESNSKSESESAASGS 348

  Fly   285 PSSTTTTTESSTTSTSIPTSTTSTTESSTTSTAIPTSTTTT--TASSTTSTAIPPSTTTTTESST 347
            .|.|..|.:.|:..|...|:.||:...|.:.:..||.:|:|  .|||..|.:.....:.:..:..
plant   349 VSKTKETNKGSSGDTYKDTTGTSSGSPSGSPSGSPTPSTSTDGKASSKGSASASAGASASASAGA 413

  Fly   348 TSTALPTSTTTTTQSPTTSTAIPTTTTTTTESPTTSTAVPTSKTTTTETPTTSTAIPTSTTTTTE 412
            :::|..::.:...:|.:.|::..::||:..|..|         .|::|..:..:.:....|..:|
plant   414 SASAEESAASQKKESNSKSSSSSSSTTSVKEVET---------QTSSEVNSFISNLEKKYTGNSE 469

  Fly   413 SSTTSTAIPTSTTTTTESSTTSTAIPTSTTTTTESSTTSTAIPTSTTTTTQSPTTSTAILTTTTT 477
            .......:.||.:.:.:.| ||.|....|...:.:|..:.|:...::..::|..|.|::.:....
plant   470 LKVFFEKLKTSMSASAKLS-TSNAKELVTGMRSAASKIAEAMMFVSSRFSKSEETKTSMASCQQE 533

  Fly   478 TTES-----PITSTAVPTSTTTTTETPTTSTAIPTSRTTTTESSTTSTPIPTSTTTTTASSTTST 537
            ..:|     .|.|..|...|.|:|:.......|......||:...|:....:|::::::||::|:
plant   534 VMQSLKELQDINSQIVSGKTVTSTQQTELKQTITKWEQVTTQFVETAASSSSSSSSSSSSSSSSS 598

  Fly   538  537
            plant   599  598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG46026NP_001303496.1 None
AT3G28790NP_189521.1 DUF1216 473..581 CDD:369060 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.