DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46026 and F59A6.3

DIOPT Version :9

Sequence 1:NP_001303496.1 Gene:CG46026 / 26067064 FlyBaseID:FBgn0267690 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_494923.1 Gene:F59A6.3 / 186581 WormBaseID:WBGene00019085 Length:786 Species:Caenorhabditis elegans


Alignment Length:621 Identity:218/621 - (35%)
Similarity:301/621 - (48%) Gaps:103/621 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SDPASTGSPTTSTTIPTTTGSSTTSTAIPTSTG-SPTTSTAIPTTTGSPTTSTAIP-TSTEPATT 192
            |||:...:..|.||...:|..:.:||::.|||. |.:|...|.|||.:..|:|..| :||:.::|
 Worm    95 SDPSPVWTNCTETTSTASTEFTISSTSLKTSTSDSTSTEPRISTTTDTKDTTTEDPVSSTDQSST 159

  Fly   193 STAIPTSTGSPTTSTAIPTSTGSPTTSPAIPTSTTTTQTPIPTST-TTTTESSTTSTAIPPSTTT 256
            |   |..|...|| |...||..|.:|.    .||..:.:|.|||. :|:|||..|.:.  .|:.|
 Worm   160 S---PHETTRDTT-TEGTTSEDSTSTY----GSTERSSSPKPTSEFSTSTESDFTEST--RSSET 214

  Fly   257 TTESSTTSTAIPTSTT---TTTASSTTSTAIPSSTTTTTESSTTSTSIPTSTTSTTESSTTSTAI 318
            |:...|.|:..|.|||   .:|:|..:.|.....||||.   .|:|...|||.|...:|.:||:.
 Worm   215 TSSIETNSSTSPVSTTPEYDSTSSGNSETTESDGTTTTV---FTTTKDDTSTVSGDSNSGSSTSE 276

  Fly   319 PTSTTTTTASSTTSTAIPPSTTTTTESSTTSTALPTSTTTTTQ--------SPTTSTAIPTTTTT 375
            ..:|.|||...:|.:....|..:..:||:.|.....|...||:        |..::...|:||:.
 Worm   277 FKNTETTTGPGSTVSEPSSSERSDLDSSSVSDRSTDSQDRTTEIGLQGPILSDDSNNPDPSTTSA 341

  Fly   376 TTE--SPTTSTAVPTSKTTTTETPTTSTAIPTSTTTTTESSTTSTAI-----PTSTTTTTESSTT 433
            .|.  :.|||.|...|...||..|:|::.   ||.:||..|..||::     |.|:.:||...:|
 Worm   342 LTSGGTSTTSRASSASDDPTTTGPSTTSG---STASTTSGSLFSTSLGSSQSPGSSVSTTPGPST 403

  Fly   434 STAIPTST----TTTTESSTT--STAIPTSTTTTTQSPTTSTAILTTTTTTTESPIT---STAVP 489
            .:.|..||    |||:|.|||  ||...||..:||..|:|:   |.||.:||..|.|   ||...
 Worm   404 ISGISQSTTSGPTTTSEPSTTSGSTVSDTSGPSTTSGPSTT---LGTTQSTTSGPSTTPGSTIST 465

  Fly   490 TSTTTTTETPTTSTAIPTSRT------TTTESSTTSTPIPTSTTTTTASSTTSTAIPPSTT---T 545
            ||:.:||..|:||:....|.|      :.|..||||.|..:|..:|.:..|.||...||||   :
 Worm   466 TSSASTTSGPSTSSGSTVSTTSGQSTSSGTTKSTTSGPTTSSGPSTVSERTLSTTSGPSTTSGPS 530

  Fly   546 TTESSTTSTAIPISTT-----TTTQSPTT----STAIPTTTTTTTESSTTSTAIPTSTTTTTASS 601
            ||..||.||....|||     :||..|:|    |||..:|.:||:..||||....||..:||:.|
 Worm   531 TTSGSTVSTTPGASTTSGSTQSTTSGPSTSSGPSTASRSTVSTTSGPSTTSGPSTTSGPSTTSGS 595

  Fly   602 TTSTAIPSSTTTTTESSTTSTAIPTSTTTTTESS-----TTSTAIPSSTTPTTLSP-------TT 654
            |.||....|||:....||.|..:..|||:.|.||     .|.|:.||:::..|.|.       ||
 Worm   596 TKSTTSGPSTTSGKNISTVSGKLTGSTTSATISSAFGGNVTFTSKPSNSSGGTTSSGKNFSQNTT 660

  Fly   655 STA---------------IPT---------STTPTT 666
            |.|               :||         ||:|:|
 Worm   661 SAANGTTQAVNNGKSGSTLPTNSSSGSSDSSTSPST 696



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.