DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and Chl1

DIOPT Version :10

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_038964701.1 Gene:Chl1 / 89828 RGDID:620122 Length:1224 Species:Rattus norvegicus


Alignment Length:468 Identity:105/468 - (22%)
Similarity:166/468 - (35%) Gaps:110/468 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CSIAFILIKAIT------ITKCHAVAHIHGKGESEEID----------------PQFLAKLSNTT 60
            |..||..::.|.      :| .:::.|.:....|.||.                |..:...|:.|
  Rat   203 CFAAFPKLRTIVQKMPMKLT-VNSLKHANDSSSSTEISNQANSIKQRKPKLLLPPAQIGSASSKT 266

  Fly    61 VPIGRDISFTCVVDNLGHYRVAWIKSDS-----KAILGIHTHMVSLNPRLSVTHNGHNTWKLHIS 120
            |..|..:...|..:.|...::.|.|..|     :|.:.||..                  .|.|.
  Rat   267 VLKGDTLLLECFAEGLPTPQIEWSKLGSELPKGRATIEIHEK------------------TLKIE 313

  Fly   121 RVQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDILNHP--EHNPEDGVCQEGGSISLMCSVTGVP 183
            .|...|.|:|.|..|....|:...:..:|..|     |  :..|:..|...|.:..|:|...|.|
  Rat   314 NVSYQDRGNYRCTANNLLGKASHDFHVIVEEP-----PRWKKKPQSAVYSTGSNGILLCEAEGEP 373

  Fly   184 RPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNV 248
            :|.:.||...     |..:.....|......| :..||:|.:....|.|.||| |..::....|:
  Rat   374 QPTIKWRVNG-----LPIENHPFPGDVMFPRE-ISFTNLQPNHTAVYQCEASN-IHGTILANANI 431

  Fly   249 -YVNFSPTVKAISQ-----LVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNISEE 307
             .|:..|.::..::     :||    ....|.|.....||....|..::....|..|.       
  Rat   432 DVVDVVPLIQTKNEENYETVVG----YSAFLHCEYFASPKATVVWEVADETHPLEGGR------- 485

  Fly   308 VINIYTWHLN--LTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTP-TPHMQTTG 369
                |..|.|  |.|...|:.|.|:|||...|.:||:.....| ::|...||...| .|.:    
  Rat   486 ----YHTHENGTLEIERTTEEDAGSYSCWVDNTMGKAVITANL-DIRNATKLRVFPKNPRI---- 541

  Fly   370 KSRRKHPASHKKGLNEVLRFQ-----ETHFANQIQQENEDHNEGFDLLKFTNSENSNIVLESGHI 429
                  |.||      ||...     ::|..:.::.......|.|::   ..:|:..||::..::
  Rat   542 ------PKSH------VLELYCESQCDSHLKHSLKLSWSKDGEAFEM---NGTEDGRIVIDGANL 591

  Fly   430 N-SMINKEDVNIY 441
            . |.|:.||..||
  Rat   592 TISNISGEDQGIY 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 21/97 (22%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand E 115..119 CDD:409353 1/3 (33%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig 153..250 CDD:472250 24/99 (24%)
Ig strand B 173..177 CDD:409353 1/3 (33%)
Ig strand C 186..190 CDD:409353 0/3 (0%)
Ig strand E 204..219 CDD:409353 2/14 (14%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 0/2 (0%)
IG_like 271..349 CDD:214653 21/79 (27%)
Ig strand B 271..275 CDD:409353 1/3 (33%)
Ig strand C 284..288 CDD:409353 0/3 (0%)
Ig strand E 308..320 CDD:409353 4/13 (31%)
Ig strand F 330..335 CDD:409353 3/4 (75%)
Chl1XP_038964701.1 Ig 34..125 CDD:472250
Ig strand B 52..56 CDD:409353
Ig strand C 65..69 CDD:409353
Ig strand E 89..93 CDD:409353
Ig strand F 105..110 CDD:409353
Ig strand G 119..122 CDD:409353
IgI_2_L1-CAM_like 134..224 CDD:409432 5/21 (24%)
Ig strand A 134..137 CDD:409432
Ig strand A' 139..143 CDD:409432
Ig strand B 146..154 CDD:409432
Ig strand C 161..167 CDD:409432
Ig strand C' 170..173 CDD:409432
Ig strand D 179..183 CDD:409432
Ig strand E 185..189 CDD:409432
Ig strand F 200..208 CDD:409432 2/4 (50%)
Ig strand G 211..224 CDD:409432 2/13 (15%)
Ig 261..343 CDD:472250 21/99 (21%)
Ig strand B 273..277 CDD:409353 0/3 (0%)
Ig strand C 286..290 CDD:409353 0/3 (0%)
Ig strand E 308..312 CDD:409353 1/21 (5%)
Ig strand F 322..327 CDD:409353 2/4 (50%)
Ig strand G 335..338 CDD:409353 0/2 (0%)
Ig4_L1-NrCAM_like 347..434 CDD:409367 23/93 (25%)
Ig strand B 363..367 CDD:409367 1/3 (33%)
Ig strand C 376..380 CDD:409367 0/3 (0%)
Ig strand E 399..403 CDD:409367 1/4 (25%)
Ig strand F 413..418 CDD:409367 2/4 (50%)
Ig strand G 426..429 CDD:409367 0/2 (0%)
Ig 447..524 CDD:472250 23/91 (25%)
Ig strand B 456..460 CDD:409353 1/3 (33%)
Ig strand C 469..473 CDD:409353 0/3 (0%)
Ig strand E 492..496 CDD:409353 1/3 (33%)
Ig strand F 506..511 CDD:409353 3/4 (75%)
Ig strand G 519..522 CDD:409353 0/2 (0%)
Ig 528..627 CDD:472250 21/96 (22%)
Ig strand B 547..551 CDD:409353 1/3 (33%)
Ig strand C 564..568 CDD:409353 0/3 (0%)
Ig strand E 589..593 CDD:409353 0/3 (0%)
Ig strand F 603..608 CDD:409353 2/2 (100%)
Ig strand G 616..619 CDD:409353
FN3 <626..>867 CDD:442628
FN3 627..716 CDD:238020
FN3 832..926 CDD:238020
FN3 931..1026 CDD:238020
Bravo_FIGEY 1120..1205 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.