DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and opcml

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001072487.1 Gene:opcml / 779942 XenbaseID:XB-GENE-5831850 Length:346 Species:Xenopus tropicalis


Alignment Length:309 Identity:93/309 - (30%)
Similarity:135/309 - (43%) Gaps:42/309 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DPQFLAKLSNTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHN 113
            |..|...:.|.||..|......|.||| ...||||:  :...||.......|::||:.:..|..:
 Frog    37 DAGFPKAMDNVTVRQGDSAILRCTVDN-RVTRVAWL--NRSTILYTGNDKWSIDPRVVLLANTKS 98

  Fly   114 TWKLHISRVQINDSGSYMCQVNTD--PMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLM 176
            .:.:.|..|.|.|.|.|.|.|.||  | |:...:|.|.|.|.|||    ...|....||.:::|.
 Frog    99 QYSIEIQNVDIYDEGPYTCSVQTDNHP-KTSRVHLIVQVAPQILN----ISSDITVNEGSTVALR 158

  Fly   177 CSVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPS 241
            |..||.|.|.|.||...||.....:|           .|.|.:|.:.|...|.|.|.|:|.:...
 Frog   159 CLATGRPEPAVTWRHFTGKSHRFVSD-----------DEYLEITGITRDQSGQYECSAANDVSAP 212

  Fly   242 VSKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNG------- 299
            ..::..|.||:.|.: :.::..||.:.::..|.|.....|.....|||.|  .:|.||       
 Frog   213 DIRKVRVTVNYPPYI-SDTRNTGASLGQKGILRCSASAVPLAEFQWYREE--TRLANGLDGVRIE 274

  Fly   300 NKYNISEEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRL 348
            ||.::|           .||..::::.|:|.|:|.:.|.||.|.:.:.|
 Frog   275 NKDHMS-----------ILTFFNVSEKDYGNYTCVASNKLGNSNASVIL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
opcmlNP_001072487.1 Ig 46..134 CDD:325142 31/91 (34%)
Ig_3 138..207 CDD:316449 27/83 (33%)
ig 228..312 CDD:278476 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.