DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and zgc:152904

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001070212.1 Gene:zgc:152904 / 767777 ZFINID:ZDB-GENE-060929-856 Length:809 Species:Danio rerio


Alignment Length:460 Identity:103/460 - (22%)
Similarity:177/460 - (38%) Gaps:82/460 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KCHAVAHIHGKGESEEID-------PQFLA---KLSNTTVPIGRDISFTCVVDNLGHYRVAWIKS 86
            :|.  |.:..:||.:..|       |..|:   :..|.|......::||||.......:|.|...
Zfish   154 RCE--ARVEARGEIDFRDIVVQVNVPPVLSVPQQSFNATADYQESVTFTCVTSGSPDPQVTWYWK 216

  Fly    87 DSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSYMCQVNTDPMKSLSG-YLDVVV 150
             ..||  .|:....||     |.||..: .|.:..::..|.|.|||:.:.....|.|. :|.|.|
Zfish   217 -GHAI--EHSEQYVLN-----TMNGGKS-TLTVKNIKQTDGGPYMCRASNKAGSSESQLFLKVFV 272

  Fly   151 PPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILRTDG-RDKTGFKSVEG 214
            .|.|.     ...:....||.:..:.|:..|.|.|::.|||.:.....  ||| :.|.|...|.|
Zfish   273 QPHIT-----QLRNVTAVEGSAAMISCTAEGEPLPEISWRRASDGHSF--TDGEKSKDGRVEVRG 330

  Fly   215 ER----LVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQLVGAPVEREVTLEC 275
            ..    |.::.||.||.|.::|.|.:.|.......| :.:.::|..:....:..:.....|.:.|
Zfish   331 RHGKSMLTISGVQLSDWGRFDCEALSRIGGHQKSMF-LDIEYAPKFQTNQSIFYSWEGNPVNISC 394

  Fly   276 IVEVFPKPLNGWYR------SEG--NIKLHNGNKYNISEEVINIYTWHLNLTIRHLTKSDFGTYS 332
            .|:..|.....|.|      |:|  ||::|:.:..::             |.:..::..|||.|:
Zfish   395 EVKSNPAATMLWRRERFTISSQGTSNIRIHSTDGRSL-------------LEVTPVSDRDFGRYN 446

  Fly   333 CSSVNALGKSESLIRLQELRLPPKLTTTPTPHMQTTGKSRRKHPASHKKGLNE--------VLRF 389
            |::.|.:|     .|.||..|......:....::.|..|:|....|..|..:.        ::.:
Zfish   447 CTARNNIG-----ARYQEFILAQADVPSSPYSVRMTAVSQRMATVSFMKPDSHGGVPISFYIINY 506

  Fly   390 QETHFANQIQQENEDHNEGFDLLKFTNSENSNIVLESGHINSMINKEDVNIYHPKQYGQEKTNKP 454
            ::|..|.:.:...            |:...:.:||.|...|:..... |:..:.|..|:....:.
Zfish   507 RDTSSAQEWRSAR------------THGVQTAVVLTSLEPNTTYEVR-VSAVNGKGQGEFSHTES 558

  Fly   455 SGTIP 459
            ..|:|
Zfish   559 FQTLP 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
zgc:152904NP_001070212.1 Ig 1..81 CDD:299845
IG_like 2..80 CDD:214653
IGc2 97..158 CDD:197706 1/5 (20%)
Ig 177..273 CDD:299845 28/104 (27%)
I-set 184..270 CDD:254352 25/94 (27%)
Ig 272..369 CDD:299845 29/104 (28%)
I-set 274..367 CDD:254352 28/100 (28%)
IG_like 385..462 CDD:214653 22/94 (23%)
IGc2 386..454 CDD:197706 18/80 (23%)
FN3 468..561 CDD:238020 15/105 (14%)
fn3 <591..650 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.