DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and Tmigd1

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001369175.1 Gene:Tmigd1 / 66601 MGIID:1913851 Length:294 Species:Mus musculus


Alignment Length:279 Identity:64/279 - (22%)
Similarity:116/279 - (41%) Gaps:74/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ACSIAFILIKAITITKCHAVAHIHGKGESEEIDPQFLAKLSNTTVPIGRDISFTCVVDNLGH--- 78
            ||.:..::: ::...:..:|..::|:.|:..:|.|.           |...|..|.|.|  |   
Mouse    44 ACQLLLVVL-SLPQGRTSSVLTVNGRTENYILDTQH-----------GVQASLECAVQN--HTED 94

  Fly    79 YRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRV---QINDSGS---YMCQVNTD 137
            ..:.|.:.|.         :|.|.       ||:   |::||.|   .||:|.:   :.|::..|
Mouse    95 EELLWYREDG---------IVDLK-------NGN---KINISSVCVSPINESDNGVRFTCKLQRD 140

  Fly   138 PMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRR-------EAGK 195
            ...|::..|:|..||.:..:.....|     |...:||:|:|...|:.:::|.:       |.|:
Mouse   141 QTVSVTVVLNVTFPPLLSGNGFQTVE-----ENSDVSLVCNVKSNPQAQMMWYKNNSALVLEKGR 200

  Fly   196 EIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAIS 260
            ..|.:|.          |..:|.:|.|::||.|.|:||||:.:... :..|::.|.....|....
Mouse   201 HQIHQTR----------ESFQLSITKVKKSDNGTYSCIASSSLKME-TMDFHLLVKDKVFVMPAE 254

  Fly   261 QLVGAPVEREVTLECIVEV 279
            .::.|         |:|.|
Mouse   255 PIIAA---------CVVVV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
Tmigd1NP_001369175.1 IG_like 163..244 CDD:214653 25/96 (26%)
Ig strand B 171..175 CDD:409353 2/3 (67%)
Ig strand C 184..188 CDD:409353 0/3 (0%)
Ig strand E 210..214 CDD:409353 1/3 (33%)
Ig strand F 224..229 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.