DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and lsamp

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001034921.1 Gene:lsamp / 664692 ZFINID:ZDB-GENE-090108-1 Length:333 Species:Danio rerio


Alignment Length:288 Identity:84/288 - (29%)
Similarity:123/288 - (42%) Gaps:36/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRV 122
            |.|:..|......|.||:... :|||:...:....|  ....||:||:.:...|...:.|.|.:|
Zfish    36 NITIRQGDTTVIRCYVDDKVS-KVAWLNRSNIIFAG--EDKWSLDPRVELVTQGQLEYSLRIQKV 97

  Fly   123 QINDSGSYMCQVNT-DPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPK 186
            .:.|.|.|.|.:.| ...|:...||.|.||..|..    ..||....||.:::|.|...|.|.|.
Zfish    98 DVFDEGPYTCSIQTKQQSKTSQVYLIVQVPAIIYK----VSEDITVNEGSNVALTCLANGRPDPA 158

  Fly   187 VLWRREAGKEIILRTDGRDKTGFKSVE----GERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFN 247
            :.||       :|.         .|.|    ||.|.::.|.||..|.|.|.|||.:.....|..|
Zfish   159 ITWR-------LLN---------PSAEALDVGEYLEISGVVRSQAGRYECKASNDVSTPDVKYVN 207

  Fly   248 VYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNISEEVINIY 312
            |.||:.|.:|.:.....| |.:...|.|.....|:|...|||.|..:    .:..:::.:|....
Zfish   208 VVVNYPPYIKDVRSSETA-VGQAGVLHCEASAVPQPEFEWYRDERRL----SSSQSLTIQVSGSR 267

  Fly   313 TWHLNLTIRHLTKSDFGTYSCSSVNALG 340
            |   .|.:.::|:.|:|.|:|.:.|.||
Zfish   268 T---VLVVANVTEEDYGNYTCVATNRLG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
lsampNP_001034921.1 Ig 34..124 CDD:299845 26/90 (29%)
IG_like 36..124 CDD:214653 26/90 (29%)
IG_like 134..197 CDD:214653 25/78 (32%)
IGc2 141..199 CDD:197706 24/73 (33%)
I-set 213..300 CDD:254352 23/88 (26%)
Ig 231..298 CDD:143165 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.