DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and DIP-delta

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:348 Identity:147/348 - (42%)
Similarity:208/348 - (59%) Gaps:22/348 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DPQFLAKLSNTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHN 113
            :|:|...:.|.||.:|||.:..|||::||.|:||||..|.:.||.||.|::|..||.|:|:. .|
  Fly    43 EPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYT-DN 106

  Fly   114 TWKLHISRVQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCS 178
            ||.||:::...:|.|.|||||||:||.|..|||.|||||:||: .|..|.....:|..:|::.|.
  Fly   107 TWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILD-IESTPSSVAVRENQNINMTCR 170

  Fly   179 VTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVS 243
            ..|.|.||::||||.|:||.:    ..|......:.:.|.||.|.|::||.|.|||:||:|||||
  Fly   171 ADGFPAPKIIWRREDGEEIAV----EKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVS 231

  Fly   244 KRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGW-YRSEGNIKLHNGNKYNISEE 307
            ||..:.|.|||.:...:||||||...:||::|..|..||.:..| |.|   :.:....||. ::.
  Fly   232 KRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNS---VMVLPSKKYK-TDY 292

  Fly   308 VINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTPHM-QTTGKS 371
            ..|.|..|:.||||:|...|||.|.|.|.|:||::|..||:.|:.||    :||:..: .||.:|
  Fly   293 TENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLP----STPSKQVTHTTVES 353

  Fly   372 RRKH--PASHKKGLNEVLRFQET 392
            |..:  |:|.    |:..:..:|
  Fly   354 RENNIIPSSR----NDTTKSLQT 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 48/92 (52%)
Ig 145..238 CDD:416386 40/97 (41%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 2/6 (33%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 4/6 (67%)
Ig strand G 230..238 CDD:409353 4/7 (57%)
Ig 242..333 CDD:416386 37/94 (39%)
Ig strand A' 250..253 CDD:409353 2/2 (100%)
Ig strand B 259..266 CDD:409353 3/6 (50%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/4 (0%)
Ig strand E 295..305 CDD:409353 4/9 (44%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11903
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
88.070

Return to query results.
Submit another query.