DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and iglon5

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:320 Identity:89/320 - (27%)
Similarity:139/320 - (43%) Gaps:34/320 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HAVAHIHG---KGESEEIDPQFLAKLSNTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIH 95
            ||:|.:..   ||.|.....:|.....|.||..|..:...|.:|....:: ||:...:  ||...
Zfish     8 HALALLLALLWKGPSGAQAAEFGHLPDNITVLEGESVVLRCKIDEEVTHK-AWLNRSN--ILFTG 69

  Fly    96 THMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSYMC--QVNTDPMKSLSGYLDVVVPPDILNHP 158
            |...||:.|:|:.:|.::.:.:.|.||.:.|.|.|.|  |....| ::...||.|.||..|:|  
Zfish    70 TDKWSLDSRVSLENNNNSDFSIRIERVMVADEGPYTCSFQARNKP-RTAHVYLIVQVPARIVN-- 131

  Fly   159 EHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQ 223
              ..:|....||..::|.|...|.|.|.:.|     |:.        |.|..: |||.|.:|.::
Zfish   132 --ISQDKSVNEGEDVNLFCLAVGRPEPTITW-----KDF--------KYGLLN-EGEFLEITEIK 180

  Fly   224 RSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWY 288
            |.....:.||.:||:.|..:::..|.||:.|.:..:..: .|.|.:...|.|.....|.....||
Zfish   181 RHQAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVKNM-PAQVGKTAILRCEAMAVPTASFEWY 244

  Fly   289 RSEGNIKLHNGNKYNISEEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRL 348
            |.:.. .:.:.|...|..|.........|:|.:|     ||.|:|.:.|.||.|.:.:.|
Zfish   245 RDDRR-PVESDNTLKIKNEKTRSLLLFTNVTEKH-----FGNYTCFASNRLGASNASMLL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 27/93 (29%)
Ig 35..123 CDD:299845 27/91 (30%)
Ig 125..>183 CDD:299845 22/75 (29%)
I-set 128..207 CDD:254352 26/96 (27%)
IG_like 217..298 CDD:214653 22/87 (25%)
ig 223..296 CDD:278476 21/78 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.