DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and NTM

DIOPT Version :10

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens


Alignment Length:395 Identity:111/395 - (28%)
Similarity:162/395 - (41%) Gaps:79/395 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KTARIKMYNGTLACSIAFILIKAITITKCHAVAHIHG----KGESEEIDPQFLAKLSNTTVPIGR 65
            ||.:.||:|     ||::.:...:.     |:....|    .|     |..|...:.|.||..|.
Human     2 KTIQPKMHN-----SISWAIFTGLA-----ALCLFQGVPVRSG-----DATFPKAMDNVTVRQGE 51

  Fly    66 DISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSY 130
            ..:..|.:|| ...||||:  :...||........|:||:.:..|....:.:.|..|.:.|.|.|
Human    52 SATLRCTIDN-RVTRVAWL--NRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPY 113

  Fly   131 MCQVNTD--PMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREA 193
            .|.|.||  | |:...:|.|.|.|.|:    ....|....||.:|||.|..||.|.|.|.||..:
Human   114 TCSVQTDNHP-KTSRVHLIVQVSPKIV----EISSDISINEGNNISLTCIATGRPEPTVTWRHIS 173

  Fly   194 GKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKA 258
            .|.:          ||.| |.|.|.:..:.|...|.|.|.|||.:...|.:|..|.||:.|.:..
Human   174 PKAV----------GFVS-EDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISE 227

  Fly   259 ISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNGNK---------------YNISEEV 308
             ::..|.||.::.||:|.....|.....||:.:.  :|..|.|               :|:||. 
Human   228 -AKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDK--RLIEGKKGVKVENRPFLSKLIFFNVSEH- 288

  Fly   309 INIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTPHMQTTGKSRR 373
                              |:|.|:|.:.|.||.:.:.|.|.||..|  .::|....::||..:..
Human   289 ------------------DYGNYTCVASNKLGHTNASIMLFELNEP--TSSTLLQEVKTTALTPW 333

  Fly   374 KHPAS 378
            |.|.:
Human   334 KGPGA 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 30/94 (32%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand E 115..119 CDD:409353 0/3 (0%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig 153..250 CDD:472250 32/96 (33%)
Ig strand B 173..177 CDD:409353 3/3 (100%)
Ig strand C 186..190 CDD:409353 1/3 (33%)
Ig strand E 204..219 CDD:409353 6/14 (43%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 0/2 (0%)
IG_like 271..349 CDD:214653 20/92 (22%)
Ig strand B 271..275 CDD:409353 2/3 (67%)
Ig strand C 284..288 CDD:409353 0/3 (0%)
Ig strand E 308..320 CDD:409353 0/11 (0%)
Ig strand F 330..335 CDD:409353 2/4 (50%)
NTMNP_001338930.1 Ig 44..132 CDD:472250 29/91 (32%)
Ig strand B 53..57 CDD:409353 0/3 (0%)
Ig strand C 65..69 CDD:409353 3/3 (100%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
Ig_3 136..205 CDD:464046 28/83 (34%)
Ig 223..307 CDD:472250 23/105 (22%)
Ig strand B 239..243 CDD:409353 2/3 (67%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 0/3 (0%)
Ig strand F 292..297 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.