DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and OPCML

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:349 Identity:96/349 - (27%)
Similarity:149/349 - (42%) Gaps:57/349 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DPQFLAKLSNTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHN 113
            |..|...:.|.||..|...:..|.:|: ...||||:  :...||.......|::||:.:..|...
Human    35 DATFPKAMDNVTVRQGESATLRCTIDD-RVTRVAWL--NRSTILYAGNDKWSIDPRVIILVNTPT 96

  Fly   114 TWKLHISRVQINDSGSYMCQVNTD--PMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLM 176
            .:.:.|..|.:.|.|.|.|.|.||  | |:...:|.|.|||.|:|    ...|....||.|::|:
Human    97 QYSIMIQNVDVYDEGPYTCSVQTDNHP-KTSRVHLIVQVPPQIMN----ISSDITVNEGSSVTLL 156

  Fly   177 CSVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPS 241
            |...|.|.|.|.||..:.||      |:   ||.| |.|.|.:::::|...|.|.|.|.|.:...
Human   157 CLAIGRPEPTVTWRHLSVKE------GQ---GFVS-EDEYLEISDIKRDQSGEYECSALNDVAAP 211

  Fly   242 VSKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNG------- 299
            ..::..:.||:.|.:.. ::..|..|.::..|.|.....|.....|::.|  .:|..|       
Human   212 DVRKVKITVNYPPYISK-AKNTGVSVGQKGILSCEASAVPMAEFQWFKEE--TRLATGLDGMRIE 273

  Fly   300 NKYNISEEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTPH 364
            ||..:|           .||..::::.|:|.|:|.:.|.||.:.:.|.|.|:          :|.
Human   274 NKGRMS-----------TLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEI----------SPS 317

  Fly   365 MQTTGKSRRKHPASHKKGLNEVLR 388
            ....|      |.:...|:|...|
Human   318 SAVAG------PGAVIDGVNSASR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
OPCMLNP_001306032.1 Ig 44..132 CDD:416386 28/91 (31%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 1/7 (14%)
CDR1 59..63 CDD:409353 1/4 (25%)
FR2 64..70 CDD:409353 4/7 (57%)
Ig strand C 64..70 CDD:409353 4/7 (57%)
CDR2 71..83 CDD:409353 2/11 (18%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 9/33 (27%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 2/3 (67%)
Ig strand G 123..132 CDD:409353 3/9 (33%)
FR4 125..132 CDD:409353 1/6 (17%)
Ig_3 135..206 CDD:404760 30/84 (36%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 3/8 (38%)
Ig strand C 165..170 CDD:409353 2/4 (50%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig 224..312 CDD:416386 23/101 (23%)
putative Ig strand A 224..230 CDD:409353 1/6 (17%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/14 (14%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.