DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and NCAM2

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:440 Identity:96/440 - (21%)
Similarity:163/440 - (37%) Gaps:107/440 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QFLAKLSNTTVPIGRDISFTCVVDNLGH-YRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNT 114
            |....||...:.:|....|||..  :|. ..:.|.....:.|:.        ..|:.|...|..:
Human    47 QVTISLSKVELSVGESKFFTCTA--IGEPESIDWYNPQGEKIIS--------TQRVVVQKEGVRS 101

  Fly   115 WKLHISRVQINDSGSYMCQVNTDP-------------MKSLSGYLDVVVPPDILNHPEHNPEDGV 166
             :|.|....|.|:|.|.||. ||.             .:.|: :.:||.|.:.            
Human   102 -RLTIYNANIEDAGIYRCQA-TDAKGQTQEATVVLEIYQKLT-FREVVSPQEF------------ 151

  Fly   167 CQEGGSISLMCSVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYN 231
             ::|....::|.|:..|.|.|.|... .:|:...:|.|    |..:....|.:.|:.:||.|.|.
Human   152 -KQGEDAEVVCRVSSSPAPAVSWLYH-NEEVTTISDNR----FAMLANNNLQILNINKSDEGIYR 210

  Fly   232 C---IASNG------------IPPSVS---KRFNVYVNFSPTVKAISQLVGAPVER--EVTLECI 276
            |   :.:.|            :||::|   |.||                 |..||  |:|..|.
Human   211 CEGRVEARGEIDFRDIIVIVNVPPAISMPQKSFN-----------------ATAERGEEMTFSCR 258

  Fly   277 VEVFPKPLNGWYRSEGNIKLHNGNKYNISEEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGK 341
            ....|:|...|:|        ||.....:|:.| :...:..||:|::..||.|.|.|.:.|..|:
Human   259 ASGSPEPAISWFR--------NGKLIEENEKYI-LKGSNTELTVRNIINSDGGPYVCRATNKAGE 314

  Fly   342 SESLIRLQELRLPPKLTTTPTPHMQTTGKSRRKHPASHKKGLNEVLRFQETHFANQIQQENEDHN 406
            .|....||         ....||:     .:.|:..:::.|...::...|.....:|..:..  .
Human   315 DEKQAFLQ---------VFVQPHI-----IQLKNETTYENGQVTLVCDAEGEPIPEITWKRA--V 363

  Fly   407 EGFDLLKFTNSENSNIVLESGHINSMINKEDVNIYHPKQYGQEKTNKPSG 456
            :||...:...|.:..|.::..|.:|.::.:||.:....:|..|..::..|
Human   364 DGFTFTEGDKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGG 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
NCAM2XP_011527877.1 Ig1_NCAM-2 46..137 CDD:143274 23/101 (23%)
I-set 47..136 CDD:254352 23/100 (23%)
I-set 142..218 CDD:254352 21/93 (23%)
IGc2 153..214 CDD:197706 18/65 (28%)
Ig 233..326 CDD:299845 33/127 (26%)
I-set 240..323 CDD:254352 30/117 (26%)
Ig5_NCAM-2 325..422 CDD:143278 17/96 (18%)
IG_like 333..420 CDD:214653 15/83 (18%)
IG_like 438..515 CDD:214653
IGc2 439..507 CDD:197706
FN3 521..613 CDD:238020
fn3 619..703 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.