DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and NCAM1

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:443 Identity:97/443 - (21%)
Similarity:182/443 - (41%) Gaps:82/443 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SNTTVPIGRDISFTC-VVDNLGHYRVAWIKSDSKAILGIHTHMVSLNP---RLSVTHNGHNTWKL 117
            |...:.:|....|.| |..:.....::|...:.:          .|.|   |:||..|..::..|
Human    27 SQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE----------KLTPNQQRISVVWNDDSSSTL 81

  Fly   118 HISRVQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGV 182
            .|....|:|:|.|.|.|..:........::|.:...::......|::  .:||....::|.|...
Human    82 TIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQE--FREGEDAVIVCDVVSS 144

  Fly   183 PRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNC---IASNGIPPSVS- 243
            ..|.::|:.: |:::||:.|.|    |..:....|.:..::::|.|.|.|   |.:.|   .:: 
Human   145 LPPTIIWKHK-GRDVILKKDVR----FIVLSNNYLQIRGIKKTDEGTYRCEGRILARG---EINF 201

  Fly   244 KRFNVYVNFSPTVKAISQLVGAPVE--REVTLECIVEVFPKPLNGWYRSEGNIKL-HNGNKYNIS 305
            |...|.||..||::|...:|.|...  :.|||.|..|.||:|...|.:....|:. .:..||..|
Human   202 KDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFS 266

  Fly   306 EEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQ--------------ELRLPPK 356
            ::       ...|||:.:.|:|...|.|.:.|..|:.::.|.|:              .:.|..:
Human   267 DD-------SSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQ 324

  Fly   357 LTTT------PTPHMQTTGKSRRKHPASHKKGLNEVLRFQETHFANQIQ---QENEDHNEGF--- 409
            :|.|      |.|.:  |.::..::.:|.:|........||.|.....|   |:.:..:.||   
Human   325 VTLTCEASGDPIPSI--TWRTSTRNISSEEKASWTRPEKQEVHAPWNWQVGRQKGQAGSAGFPGS 387

  Fly   410 ------DLLKFTNSENSNIVLES------GH----INSMINKEDVNIYHPKQY 446
                  .::..:::..|::.|:|      |.    .::.|.::..::|...||
Human   388 HETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQY 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 21/97 (22%)
IG 124..190 CDD:214652 17/72 (24%)
Ig 211..307 CDD:325142 29/102 (28%)
Ig 306..438 CDD:325142 21/133 (16%)
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.