DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and opcml

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:301 Identity:84/301 - (27%)
Similarity:132/301 - (43%) Gaps:44/301 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRV 122
            |.||..|......|.:||... ||||:  :...||.......||:||:.:.:...|.:.:.|..|
Zfish    41 NITVRQGDSAVLKCSMDNKVS-RVAWL--NRTTILFTGNEKWSLDPRVVLLNTAVNEYSIKILNV 102

  Fly   123 QINDSGSYMCQVNTDPM-KSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPK 186
            .:.|.|.|:|.:.|:.. :|...:|.|.||..|:|    ...|....||.::||||...|.|.|.
Zfish   103 NLYDEGPYVCSILTNKKPESTKVHLIVQVPARIVN----VSTDVSVNEGSNVSLMCLAIGRPEPS 163

  Fly   187 VLW--RREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVY 249
            :||  |...|..|:             .|||.:.:|.:.:...|.|:||.||.|.|...:...|.
Zfish   164 ILWKFRSSKGNRIV-------------TEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVT 215

  Fly   250 VNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSE-------GNIKLHNGNKYNISEE 307
            ||:.|.:.. ::..|..|.::..|.|.....|.....|::.|       ..:|:.|..|.::   
Zfish   216 VNYPPVISR-ARSTGTAVGQKGVLWCEASAVPLADFQWFKGERRILNGFNGVKIENKGKQSM--- 276

  Fly   308 VINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRL 348
                      ||..::::.|:|.|:|.::|.||.:.:.|.|
Zfish   277 ----------LTFFNVSEEDYGNYTCVAINTLGITNASIIL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
opcmlNP_001005580.1 Ig 41..129 CDD:299845 27/90 (30%)
IG_like 41..129 CDD:214653 27/90 (30%)
IG_like 139..216 CDD:214653 28/89 (31%)
IGc2 146..202 CDD:197706 22/68 (32%)
I-set 219..307 CDD:254352 21/101 (21%)
ig 223..307 CDD:278476 20/97 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.