DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and DIP-gamma

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:402 Identity:150/402 - (37%)
Similarity:220/402 - (54%) Gaps:45/402 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KMYNGTLACSIAFILIKAITITKC--HAVAHIHGKGESE-EIDPQFLAKLSNTTVPIGRDISFTC 71
            |:...||     |:::  |..|||  .:..:.|.:..|: :.||:|:..::|.|.|.||:....|
  Fly     3 KLLQSTL-----FVIL--IMATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILAC 60

  Fly    72 VVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSYMCQVNT 136
            .|.|||..:|.|:::..:.:|.:...:|:.|.|:||.|...:||||.||:::.:|.|.||||:||
  Fly    61 SVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINT 125

  Fly   137 DPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILRT 201
            .|||...|.:||.|||||:|  |.:..|...|||...:|.|..||.|:|:|.||||.|:.|::|.
  Fly   126 SPMKKQVGCIDVQVPPDIIN--EESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRK 188

  Fly   202 DG-RDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQLVGA 265
            .| |:....:|..|..|.|..::|..||.|.|||||.:||:||||.::.|.|:|.|:|.|||:|.
  Fly   189 PGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGT 253

  Fly   266 PVEREVTLECIVEVFPKPLNGWYR-------------------SEGNIKLHNGNKYNISEEVINI 311
            |:..:|.|||.||..|.|::.|.:                   |.|...|.:|.||.|:|. .:.
  Fly   254 PLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITER-RDG 317

  Fly   312 YTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTPHMQTTGKSRRKHP 376
            |...:.|.:|..:.||.|||.|.|.|:||::|..:||.|::|.|..:.:...|:...|       
  Fly   318 YRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASASNDDHLNYIG------- 375

  Fly   377 ASHKKGLNEVLR 388
                 ||.|..|
  Fly   376 -----GLEEAAR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 39/91 (43%)
Ig 47..129 CDD:299845 34/81 (42%)
Ig 140..238 CDD:299845 45/99 (45%)
IG_like 247..355 CDD:214653 37/108 (34%)
Ig 256..351 CDD:299845 31/95 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
88.070

Return to query results.
Submit another query.