DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and DIP-gamma

DIOPT Version :10

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:402 Identity:150/402 - (37%)
Similarity:220/402 - (54%) Gaps:45/402 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KMYNGTLACSIAFILIKAITITKC--HAVAHIHGKGESE-EIDPQFLAKLSNTTVPIGRDISFTC 71
            |:...||     |:::  |..|||  .:..:.|.:..|: :.||:|:..::|.|.|.||:....|
  Fly     3 KLLQSTL-----FVIL--IMATKCGSGSTQNQHHESSSQLDPDPEFIGFINNVTYPAGREAILAC 60

  Fly    72 VVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSYMCQVNT 136
            .|.|||..:|.|:::..:.:|.:...:|:.|.|:||.|...:||||.||:::.:|.|.||||:||
  Fly    61 SVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQDMHTWKLKISKLRESDRGCYMCQINT 125

  Fly   137 DPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILRT 201
            .|||...|.:||.|||||:|  |.:..|...|||...:|.|..||.|:|:|.||||.|:.|::|.
  Fly   126 SPMKKQVGCIDVQVPPDIIN--EESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMILIRK 188

  Fly   202 DG-RDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQLVGA 265
            .| |:....:|..|..|.|..::|..||.|.|||||.:||:||||.::.|.|:|.|:|.|||:|.
  Fly   189 PGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGT 253

  Fly   266 PVEREVTLECIVEVFPKPLNGWYR-------------------SEGNIKLHNGNKYNISEEVINI 311
            |:..:|.|||.||..|.|::.|.:                   |.|...|.:|.||.|:|. .:.
  Fly   254 PLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITER-RDG 317

  Fly   312 YTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTPHMQTTGKSRRKHP 376
            |...:.|.:|..:.||.|||.|.|.|:||::|..:||.|::|.|..:.:...|:...|       
  Fly   318 YRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLHPGASASNDDHLNYIG------- 375

  Fly   377 ASHKKGLNEVLR 388
                 ||.|..|
  Fly   376 -----GLEEAAR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 39/92 (42%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand E 115..119 CDD:409353 3/3 (100%)
Ig strand F 129..134 CDD:409353 3/4 (75%)
Ig 153..250 CDD:472250 43/97 (44%)
Ig strand B 173..177 CDD:409353 1/3 (33%)
Ig strand C 186..190 CDD:409353 1/3 (33%)
Ig strand E 204..219 CDD:409353 4/14 (29%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 2/2 (100%)
IG_like 271..349 CDD:214653 32/96 (33%)
Ig strand B 271..275 CDD:409353 2/3 (67%)
Ig strand C 284..288 CDD:409353 0/3 (0%)
Ig strand E 308..320 CDD:409353 2/11 (18%)
Ig strand F 330..335 CDD:409353 3/4 (75%)
DIP-gammaNP_651649.1 Ig 47..129 CDD:472250 34/81 (42%)
Ig strand B 56..60 CDD:409353 0/3 (0%)
Ig strand C 69..73 CDD:409353 1/3 (33%)
Ig strand E 104..108 CDD:409353 3/3 (100%)
Ig strand F 118..123 CDD:409353 3/4 (75%)
Ig 141..238 CDD:472250 44/98 (45%)
Ig strand B 160..164 CDD:409562 1/3 (33%)
Ig strand C 173..177 CDD:409562 1/3 (33%)
Ig strand E 203..207 CDD:409562 1/3 (33%)
Ig strand F 217..222 CDD:409562 2/4 (50%)
Ig strand G 231..234 CDD:409562 2/2 (100%)
IG_like 247..355 CDD:214653 37/108 (34%)
Ig strand B 259..263 CDD:409358 2/3 (67%)
Ig strand C 272..276 CDD:409358 0/3 (0%)
Ig strand E 317..326 CDD:409358 2/8 (25%)
Ig strand F 336..341 CDD:409358 3/4 (75%)

Return to query results.
Submit another query.