DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and dpr5

DIOPT Version :10

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:212 Identity:67/212 - (31%)
Similarity:91/212 - (42%) Gaps:30/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EEIDPQFLAKLSNTT-----VPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRL 105
            :.|||.|    .|||     ..:|......|.|.:||...|:||:.....||.|.....:.:.|.
  Fly    86 DAIDPVF----DNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTYTNDQRF 146

  Fly   106 SVTH-NGHNTWKLHISRVQINDSGSYMCQVNTDPMKSLSGYLDVVV-PPDILNHPEHNPEDGVCQ 168
            ...| :..:.|.|.|..||..|:|.|.|||:|:|..||:..|.||. ...||.:.|.     ..|
  Fly   147 LARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANREL-----FIQ 206

  Fly   169 EGGSISLMCSVTGVPRP--KVLWRREAGKEIILRTDGRDKTGFKSVEGER------LVLTNVQRS 225
            .|..|:|.|.....|.|  .:||.::.  |::    .....|...||.|:      ||::.||.:
  Fly   207 SGSDINLTCIAPQAPGPYTHMLWHKDT--ELV----SDSARGGIRVESEQQMKTSNLVISRVQHT 265

  Fly   226 DMGGYNCIASNGIPPSV 242
            |.|.|.|.|.|....||
  Fly   266 DSGNYTCSADNSNSDSV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 33/98 (34%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand E 115..119 CDD:409353 2/3 (67%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig 153..250 CDD:472250 29/98 (30%)
Ig strand B 173..177 CDD:409353 2/3 (67%)
Ig strand C 186..190 CDD:409353 1/3 (33%)
Ig strand E 204..219 CDD:409353 5/20 (25%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 67/212 (32%)
IG_like 271..349 CDD:214653
Ig strand B 271..275 CDD:409353
Ig strand C 284..288 CDD:409353
Ig strand E 308..320 CDD:409353
Ig strand F 330..335 CDD:409353
dpr5NP_650080.3 FR1 96..113 CDD:409355 2/16 (13%)
IG_like 98..179 CDD:214653 24/80 (30%)
Ig strand A' 100..102 CDD:409355 0/1 (0%)
Ig strand B 106..114 CDD:409355 1/7 (14%)
CDR1 114..120 CDD:409355 3/5 (60%)
FR2 121..132 CDD:409355 3/10 (30%)
Ig strand C 121..127 CDD:409355 3/5 (60%)
Ig strand C' 130..133 CDD:409355 0/2 (0%)
CDR2 133..146 CDD:409355 2/12 (17%)
Ig strand D 146..151 CDD:409355 0/4 (0%)
FR3 147..176 CDD:409355 10/28 (36%)
Ig strand E 155..162 CDD:409355 2/6 (33%)
Ig strand F 170..177 CDD:409355 4/6 (67%)
IG_like 206..278 CDD:214653 24/77 (31%)
Ig strand B 211..215 CDD:409353 2/3 (67%)
Ig strand C 226..230 CDD:409353 1/3 (33%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.