DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and LSAMP

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:331 Identity:102/331 - (30%)
Similarity:154/331 - (46%) Gaps:36/331 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRV 122
            |.||..|......|||:: .:.:|||: :.|..|...|... ||:||:.:.......:.|.|.:|
Human    40 NITVRQGDTAILRCVVED-KNSKVAWL-NRSGIIFAGHDKW-SLDPRVELEKRHSLEYSLRIQKV 101

  Fly   123 QINDSGSYMCQVNT--DPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRP 185
            .:.|.|||.|.|.|  :| |:...||.|.|||.|.|    ...|....||.:::|:|...|.|.|
Human   102 DVYDEGSYTCSVQTQHEP-KTSQVYLIVQVPPKISN----ISSDVTVNEGSNVTLVCMANGRPEP 161

  Fly   186 KVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYV 250
            .:.||.       |...||:..|    |.|.|.:..:.|...|.|.|.|:|.:..:..|:..|.|
Human   162 VITWRH-------LTPTGREFEG----EEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTV 215

  Fly   251 NFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNISEEVINIYTWH 315
            |:.||:.. |:...|...|:.:|:|.....|.|...|||.:..|...||.:...:|       ..
Human   216 NYPPTITE-SKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTE-------GQ 272

  Fly   316 LNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTP--HMQTTGKSRRKHPAS 378
            .:||:.::|:..:|.|:|.:.|.||.:.:.:.|.:..||    |.|.|  .:.||...::|.|.|
Human   273 SSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLP----TIPHPIQEIGTTVHFKQKGPGS 333

  Fly   379 HKKGLN 384
             .:|:|
Human   334 -VRGIN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 31/91 (34%)
Ig 132..215 CDD:386229 28/97 (29%)
Ig_3 219..294 CDD:372822 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.