DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and TMIGD1

DIOPT Version :10

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_996663.1 Gene:TMIGD1 / 388364 HGNCID:32431 Length:262 Species:Homo sapiens


Alignment Length:269 Identity:63/269 - (23%)
Similarity:115/269 - (42%) Gaps:65/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FILIKAITITK--CHAVAHIHGKGESEEIDPQFLAKLSNTTVPIGRDISFTCVVDNLGHYR---V 81
            |:|:..:.:.:  ..:|..::||.|:..:|          |.| |...|..|.|.|  |.|   :
Human    14 FLLLVILFLPREMTSSVLTVNGKTENYILD----------TTP-GSQASLICAVQN--HTREEEL 65

  Fly    82 AWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSG-SYMCQVNTDPMKSLSGY 145
            .|.:.:.:..|              .:.|..|:..:.:|.:..||:| |:.|::..|...|:|..
Human    66 LWYREEGRVDL--------------KSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVV 116

  Fly   146 LDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRR-------EAGKEIILRTDG 203
            |:|..||.:..:.....|     ||.::.|:|:|...|:.:::|.:       |..:..|.:|. 
Human   117 LNVTFPPLLSGNDFQTVE-----EGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTS- 175

  Fly   204 RDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQLVGAPVE 268
                     |..:|.:|.|::.|.|.|:|||.:.: .:.|..|::.|.        .:.||.|:|
Human   176 ---------ESFQLSITKVEKPDNGTYSCIAKSSL-KTESLDFHLIVK--------DKTVGVPIE 222

  Fly   269 REVTLECIV 277
             .:...|:|
Human   223 -PIIAACVV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 24/96 (25%)
Ig strand B 67..71 CDD:409353 1/3 (33%)
Ig strand E 115..119 CDD:409353 0/3 (0%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig 153..250 CDD:472250 23/103 (22%)
Ig strand B 173..177 CDD:409353 1/3 (33%)
Ig strand C 186..190 CDD:409353 0/3 (0%)
Ig strand E 204..219 CDD:409353 2/14 (14%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 1/2 (50%)
IG_like 271..349 CDD:214653 2/7 (29%)
Ig strand B 271..275 CDD:409353 0/3 (0%)
Ig strand C 284..288 CDD:409353
Ig strand E 308..320 CDD:409353
Ig strand F 330..335 CDD:409353
TMIGD1NP_996663.1 IG_like 131..212 CDD:214653 23/96 (24%)
Ig strand B 139..143 CDD:409353 1/3 (33%)
Ig strand C 152..156 CDD:409353 0/3 (0%)
Ig strand E 178..182 CDD:409353 1/3 (33%)
Ig strand F 192..197 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.