DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and Tmigd1

DIOPT Version :10

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001128501.1 Gene:Tmigd1 / 363654 RGDID:1307444 Length:261 Species:Rattus norvegicus


Alignment Length:272 Identity:66/272 - (24%)
Similarity:116/272 - (42%) Gaps:58/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TLACSIAFILIKAITITKCHAVAHIHGKGESEEIDPQFLAKLSNTTVPIGRDISFTCVVDNLGHY 79
            :|..|...:|:.::...:..:|..::|:.|...:|..:           |...|..|.|.|  |.
  Rat     8 SLTASQLLLLVLSLPQGRTSSVLTVNGRTEDYILDTYY-----------GIQASLECAVQN--HT 59

  Fly    80 R---VAWIKSDSKAILGIHTHMVSLNPRLSVTHNGH--NTWKLHISRVQINDSG-SYMCQVNTDP 138
            |   :.|.:...:..|                .||:  ||..:.:|.:..:|:| |:.|::..|.
  Rat    60 RDEELLWYREAGRVDL----------------KNGNKINTSSVCVSPINESDNGVSFTCKLQRDQ 108

  Fly   139 MKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRR-------EAGKE 196
            ..|::..|:|..||.:..:.....|     ||..:.|:|:|...|:.::||.|       |.|:.
  Rat   109 TVSITVVLNVTFPPLLSGNGFQTVE-----EGSDVRLVCNVKSNPQAQMLWYRNNSALVLEKGRH 168

  Fly   197 IILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQ 261
            .|.:|.          |..:|.:|.|::||.|.||||||:.: .:.:..|::.|.....|..|..
  Rat   169 QIQQTR----------ESFQLSITRVKKSDNGTYNCIASSSL-KTETMDFHLVVKDKVPVMPIEP 222

  Fly   262 LVGAPVEREVTL 273
            ::.|.|...:||
  Rat   223 IIAACVVVFLTL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 22/98 (22%)
Ig strand B 67..71 CDD:409353 1/3 (33%)
Ig strand E 115..119 CDD:409353 0/3 (0%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig 153..250 CDD:472250 28/103 (27%)
Ig strand B 173..177 CDD:409353 1/3 (33%)
Ig strand C 186..190 CDD:409353 1/3 (33%)
Ig strand E 204..219 CDD:409353 2/14 (14%)
Ig strand F 229..234 CDD:409353 3/4 (75%)
Ig strand G 243..246 CDD:409353 0/2 (0%)
IG_like 271..349 CDD:214653 2/3 (67%)
Ig strand B 271..275 CDD:409353 2/3 (67%)
Ig strand C 284..288 CDD:409353
Ig strand E 308..320 CDD:409353
Ig strand F 330..335 CDD:409353
Tmigd1NP_001128501.1 IG_like 130..211 CDD:214653 28/96 (29%)
Ig strand B 138..142 CDD:409353 1/3 (33%)
Ig strand C 151..155 CDD:409353 1/3 (33%)
Ig strand E 177..181 CDD:409353 1/3 (33%)
Ig strand F 191..196 CDD:409353 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.