DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and Tmigd1

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001128501.1 Gene:Tmigd1 / 363654 RGDID:1307444 Length:261 Species:Rattus norvegicus


Alignment Length:272 Identity:66/272 - (24%)
Similarity:116/272 - (42%) Gaps:58/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TLACSIAFILIKAITITKCHAVAHIHGKGESEEIDPQFLAKLSNTTVPIGRDISFTCVVDNLGHY 79
            :|..|...:|:.::...:..:|..::|:.|...:|..:           |...|..|.|.|  |.
  Rat     8 SLTASQLLLLVLSLPQGRTSSVLTVNGRTEDYILDTYY-----------GIQASLECAVQN--HT 59

  Fly    80 R---VAWIKSDSKAILGIHTHMVSLNPRLSVTHNGH--NTWKLHISRVQINDSG-SYMCQVNTDP 138
            |   :.|.:...:..|                .||:  ||..:.:|.:..:|:| |:.|::..|.
  Rat    60 RDEELLWYREAGRVDL----------------KNGNKINTSSVCVSPINESDNGVSFTCKLQRDQ 108

  Fly   139 MKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRR-------EAGKE 196
            ..|::..|:|..||.:..:.....|     ||..:.|:|:|...|:.::||.|       |.|:.
  Rat   109 TVSITVVLNVTFPPLLSGNGFQTVE-----EGSDVRLVCNVKSNPQAQMLWYRNNSALVLEKGRH 168

  Fly   197 IILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQ 261
            .|.:|.          |..:|.:|.|::||.|.||||||:.: .:.:..|::.|.....|..|..
  Rat   169 QIQQTR----------ESFQLSITRVKKSDNGTYNCIASSSL-KTETMDFHLVVKDKVPVMPIEP 222

  Fly   262 LVGAPVEREVTL 273
            ::.|.|...:||
  Rat   223 IIAACVVVFLTL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
Tmigd1NP_001128501.1 IG_like 130..211 CDD:214653 28/96 (29%)
Ig strand B 138..142 CDD:409353 1/3 (33%)
Ig strand C 151..155 CDD:409353 1/3 (33%)
Ig strand E 177..181 CDD:409353 1/3 (33%)
Ig strand F 191..196 CDD:409353 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11357
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.