DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and DIP-iota

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:378 Identity:148/378 - (39%)
Similarity:218/378 - (57%) Gaps:33/378 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SIAFILIKAITITKCHAVAHIHGKGESEEIDPQFLAKLSNTTVPIGRDISFTCVVDNLGHYRVAW 83
            |...:|::::    |.:.|..   .|....||:|...::|:|||:|||...||||.:|..::|||
  Fly     7 SFWLLLLQSV----CFSQASF---SELNNSDPKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAW 64

  Fly    84 IKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSYMCQVNTDPMKSLSGYLDV 148
            ::.|::.||.|..|:::.|.|:|::|..|..|:|.|..||.:|.|.||||:|||||||..|||||
  Fly    65 LRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDV 129

  Fly   149 VVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVE 213
            ||||||:::  ...:|.|...|.:::|.||.||||.|.:.||||....|::..|| |:..| |||
  Fly   130 VVPPDIVDY--QTSQDVVRSTGQNVTLTCSATGVPMPTITWRREEATPILISDDG-DREVF-SVE 190

  Fly   214 GERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVE 278
            |:.|.|..||||.||.|.||||||:||:||||..:.|||:||:......:...:.:::|||||.|
  Fly   191 GQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTRYDTIYVGLGQKLTLECITE 255

  Fly   279 VFPKPLNGWYRSEGNIKLHNGNKYNISEEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSE 343
            ..|..:|.|.|..   :|..|..|. |..|.:::...:.:|:|.:||.|||.|.|.:.||:|:::
  Fly   256 SQPASVNFWLRDS---QLLQGGSYE-SVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTD 316

  Fly   344 SLIRLQELRLPPKLTTTPTPHMQTTGKSRRKHPASHKKGLNEVLRFQETHFAN 396
            .:|               |.|.:.....:..|..|.::....|:   |.:.||
  Fly   317 RII---------------TVHHKAKKHGQHSHQTSSRESQFIVI---EEYIAN 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 43/85 (51%)
Ig 39..122 CDD:299845 41/82 (50%)
Ig 132..213 CDD:299845 40/84 (48%)
IG_like 141..227 CDD:214653 45/87 (52%)
IG_like 239..322 CDD:214653 29/101 (29%)
IGc2 245..313 CDD:197706 26/71 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
76.970

Return to query results.
Submit another query.